DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and Hoxa7

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_034585.1 Gene:Hoxa7 / 15404 MGIID:96179 Length:229 Species:Mus musculus


Alignment Length:217 Identity:58/217 - (26%)
Similarity:81/217 - (37%) Gaps:45/217 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DSEPEPEKLKPSSDRE------RSISKSPPLCCRDLGLYKLTQPKEIQPSARQPSNYLQYYAAAM 102
            ::||......|:|.|.      .:.:.:.|      |||.:..|....|       :...|....
Mouse    23 NAEPTSCSFAPNSQRSGYGPGAGAFASTVP------GLYNVNSPLYQSP-------FASGYGLGA 74

  Fly   103 DNNNHHHQATGTSNSSAADYMQRKLAYFGSTLAAPLDMRRCTSNDSDCDSPPPLSSSPSESPLS- 166
            |          ..|...|.|.|..     ..|.:.|....|...|..      :...|:|:... 
Mouse    75 D----------AYNLPCASYDQNI-----PGLCSDLAKGACDKADEG------VLHGPAEASFRI 118

  Fly   167 ---HDGSGLSRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRY 228
               ...||..| ||.|..::..|..|||:.|...|||:...|.|:|.:|.|||.|:||||||||.
Mouse   119 YPWMRSSGPDR-KRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRM 182

  Fly   229 KTKRKQIQQHEAALLGASKRVP 250
            |.|::...:.:|........||
Mouse   183 KWKKEHKDESQAPTAAPEDAVP 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 26/52 (50%)
Hoxa7NP_034585.1 Antp-type hexapeptide 118..123 0/4 (0%)
Homeobox 133..185 CDD:278475 26/51 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..229 3/19 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.