DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and Hmx1

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_034575.1 Gene:Hmx1 / 15371 MGIID:107178 Length:332 Species:Mus musculus


Alignment Length:333 Identity:94/333 - (28%)
Similarity:130/333 - (39%) Gaps:86/333 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DSEPEPEKLKPSSDRERSISKSP--PLCCRDLGLYKLTQPKEIQPSARQPSNYLQYYAAAMDNNN 106
            |.:||..:.:....|::.....|  ....|.|||.....|....|.|.......::|...     
Mouse    54 DEDPEQARRRLQRRRQQRAGSGPGGEARARALGLGPRPPPGPGPPFALGCGGTTRWYPRV----- 113

  Fly   107 HHHQATGTSNSSAADYMQRKLAYFGSTLAAPLDMRRCTSNDSDCDSP------------------ 153
            |.....|.|    .|...|.....|.      :|.|..|....|..|                  
Mouse   114 HGGYGGGLS----PDTSDRDSPETGE------EMGRAESAWPRCPGPGTVPREVTTQGPATGGEE 168

  Fly   154 -PPLSSSPSESPLSHDGSGLSRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTET 217
             ..|:.:|:.:..:...:...|:|::|..||.:|||:||..|..:||||..||:.:|.||:||||
Mouse   169 AAELAEAPAVAAAATGEARGGRRKKTRTVFSRSQVFQLESTFDLKRYLSSAERAGLAASLQLTET 233

  Fly   218 QVKIWFQNRRYKTKRKQIQQHEAALL---GASKRVPVQVLVREDGSTTYAHMAAPGAGHGLDPAL 279
            ||||||||||.|.||:...:.|||.|   ||.:.|.|.||..|          :|.|..|  |||
Mouse   234 QVKIWFQNRRNKWKRQLAAELEAASLSPPGAQRLVRVPVLYHE----------SPPAAAG--PAL 286

  Fly   280 INIYRHQLQLAYGGLPLPQMQMPFPYFYPQHKVPQPIPPP-----TQSSSFVTASSASSSPVPI- 338
                                  |||.     ..|.|.|||     :.:.::..|:..:::.||. 
Mouse   287 ----------------------PFPL-----APPAPAPPPPLLGFSGALAYPLAAFPAAASVPFL 324

  Fly   339 --PIPGAV 344
              .:||.|
Mouse   325 RAQMPGLV 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 33/52 (63%)
Hmx1NP_034575.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 28..170 24/130 (18%)
Homeobox 194..247 CDD:278475 33/52 (63%)
HMX family specific domain 1 251..261 4/9 (44%)
HMX family specific domain 2 264..277 6/22 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.