DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and NKX2-6

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001129743.2 Gene:NKX2-6 / 137814 HGNCID:32940 Length:301 Species:Homo sapiens


Alignment Length:313 Identity:94/313 - (30%)
Similarity:123/313 - (39%) Gaps:104/313 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LSKSLTTPFSINDIL----------------TRSNPETRRMSSVDSEPEPEKLKPS----SDRER 60
            ||...:||||:.|||                .|.:||..:...:|:||...::..:    .||:.
Human     3 LSPVTSTPFSVKDILRLERERSCPAASPHPRVRKSPENFQYLRMDAEPRGSEVHNAGGGGGDRKL 67

  Fly    61 SISKSPPLCCR---DLGLYKLTQPKEIQPSARQPSNYLQYYAAAMDNNNHHHQATGTSNSSAADY 122
            ..|:.|...|.   ::...::.:|        ||                               
Human    68 DGSEPPGGPCEAVLEMDAERMGEP--------QP------------------------------- 93

  Fly   123 MQRKLAYFGSTLAAPLD-----MRRCTSNDSDCDSPPPLSSSPSESPLSHDGSGLSRKKRSRAAF 182
                    |...|:||.     ..|...|..|     .:....||.|.:.      ::::.|..|
Human    94 --------GLNAASPLGGGTRVPERGVGNSGD-----SVRGGRSEQPKAR------QRRKPRVLF 139

  Fly   183 SHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQQHEAALLG--- 244
            |.|||..|||||.||||||.|||..:|.:|:||.|||||||||||||.|| |.|.....|.|   
Human   140 SQAQVLALERRFKQQRYLSAPEREHLASALQLTSTQVKIWFQNRRYKCKR-QRQDKSLELAGHPL 203

  Fly   245 ASKRVPVQVLVREDGSTTYAHMAAPGAGHGLDP----ALINIYRHQLQLAYGG 293
            ..:||.|.|||| ||..    ...||.|....|    |.::.|.     .|||
Human   204 TPRRVAVPVLVR-DGKP----CLGPGPGAPAFPSPYSAAVSPYS-----CYGG 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 37/52 (71%)
NKX2-6NP_001129743.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..135 24/170 (14%)
HOX 132..188 CDD:197696 37/55 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.