DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and AgaP_AGAP001619

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_321480.4 Gene:AgaP_AGAP001619 / 1281555 VectorBaseID:AGAP001619 Length:433 Species:Anopheles gambiae


Alignment Length:264 Identity:68/264 - (25%)
Similarity:93/264 - (35%) Gaps:88/264 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 SSVDSEPEPEKLKPSSD----RERSISKSPPLCCRDLGLYK-----------LTQPKEIQPSARQ 90
            ||..|.|...:|.|..:    ..||...||..|.......|           |.:|..:.|:. .
Mosquito   149 SSRSSPPPATRLSPECEARNAHPRSPHHSPAPCAGSPATNKGPIMVPGIPAGLVRPFPMAPNG-D 212

  Fly    91 PSNYLQYYAAAMDNNN---------HHHQATGTSNSSAADYMQRKLAYFGSTLAAPLDMRRCTSN 146
            |...|..:   |..|:         |:.|.......:|..::..:...||.              
Mosquito   213 PLKPLPPF---MGGNSAAELAVQAAHNQQFLAAQFQAALAHVHGQHGGFGG-------------- 260

  Fly   147 DSDCDSPPPLSSSPSESP----------LSHDGSGL----------------------------- 172
                 .|..|.:.|:..|          ||..|..:                             
Mosquito   261 -----HPAHLHNHPANMPRESYPLYPWLLSRHGRNVFPPRFPGSKYEVWCLKLLILNIKRYLLPF 320

  Fly   173 SRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQQ 237
            .:.||.|.|||.:|:.:||..|....|:.|.||..:|:||.|||||||:||||||  ||.|::||
Mosquito   321 RKPKRVRTAFSPSQLLKLEHAFENNHYVVGAERKSLAQSLSLTETQVKVWFQNRR--TKHKRMQQ 383

  Fly   238 HEAA 241
            .|.|
Mosquito   384 EEDA 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 28/52 (54%)
AgaP_AGAP001619XP_321480.4 Homeobox 327..379 CDD:278475 30/53 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.