DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and AgaP_AGAP011417

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_317892.4 Gene:AgaP_AGAP011417 / 1278279 VectorBaseID:AGAP011417 Length:603 Species:Anopheles gambiae


Alignment Length:306 Identity:80/306 - (26%)
Similarity:108/306 - (35%) Gaps:101/306 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 LTQPKEIQPSARQPSNYLQYYAAAMDNNNHHHQATGTSNSSAADYMQRKLAYFGS--TLAAPLDM 140
            |..|.:..|:..||..               ....||..|..:          ||  ||.:| |.
Mosquito   204 LWSPGQGMPNMSQPGG---------------STTPGTIGSPGS----------GSHETLGSP-DG 242

  Fly   141 RRC------TSND--SDCDSP---------PPLSSSPS----ESPLSHDGSGLSRKKRSRAAFSH 184
            .|.      ||:|  |...||         |.:||..:    |...|.||. ..:.:|:|..||.
Mosquito   243 NRLIGRYFKTSSDVISQYISPNLCTHDVFEPRISSLTTDIEGEDSNSLDGD-QPKFRRNRTTFSP 306

  Fly   185 AQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQQHEAALLGASKRV 249
            .|:.|||:.|.:..|.....|..:|....|:|.:|::||.|||.|.:|.|               
Mosquito   307 EQLEELEKEFDKSHYPCVSTRERLASRTSLSEARVQVWFSNRRAKWRRHQ--------------- 356

  Fly   250 PVQVLVREDGSTTYAHMAAPGAGHGLDPALINIYRHQLQLAYGGLPLPQMQMPFPYFYPQHKVPQ 314
            .:.:|.|....||.|..||..|.....|               |.|.|..|       ||.:..|
Mosquito   357 RMNLLKRSTSPTTRAAAAAGTASSAFTP---------------GSPPPPPQ-------PQQQQQQ 399

  Fly   315 P-----IPPPTQSSSFVTASS-----ASSSP----VPIPIPGAVRP 346
            |     .||.|..|:.:..||     |::||    :|..:.|...|
Mosquito   400 PPTAGSQPPGTSPSAQLAPSSGSPGGAAASPHHHHLPPHLAGVHLP 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 20/52 (38%)
AgaP_AGAP011417XP_317892.4 HTH 72..168 CDD:304362
Homeobox 301..353 CDD:278475 20/51 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.