DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and AgaP_AGAP004660

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_311618.2 Gene:AgaP_AGAP004660 / 1272720 VectorBaseID:AGAP004660 Length:324 Species:Anopheles gambiae


Alignment Length:202 Identity:60/202 - (29%)
Similarity:78/202 - (38%) Gaps:51/202 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 QPKEIQPSARQPSNY----LQYYAAAMDNNNHHHQATGTSNSS-AADYM---------------- 123
            |..::||..:||..|    ||   ||:.|..:.....||.|.| ..|.|                
Mosquito   104 QQTQVQPQQQQPIVYASCKLQ---AAVGNGPNGLGTYGTENGSPPLDQMGHHMGTAQMTIPQHHM 165

  Fly   124 ---QRKLAYFGSTLAAPLDMRRCTSNDSD------------CDSPPPLSSSPSESPLSHD-GSGL 172
               |.:..|.......|..|...|:....            ...||||.......|.|.: .|||
Mosquito   166 GHSQGQECYPEQVHQTPQHMAMYTNAGGGPPGVTQQQPNMMHQQPPPLHQGQQAPPNSQNASSGL 230

  Fly   173 S-----------RKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNR 226
            .           .:||.|..::..|..|||:.|...|||:...|.|:|.:|.|||.|:|||||||
Mosquito   231 QSPLYPWMRSQFERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNR 295

  Fly   227 RYKTKRK 233
            |.|.|::
Mosquito   296 RMKWKKE 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 26/52 (50%)
AgaP_AGAP004660XP_311618.2 Homeobox 248..300 CDD:278475 26/51 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.