DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and AgaP_AGAP010358

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_559100.2 Gene:AgaP_AGAP010358 / 1272681 VectorBaseID:AGAP010358 Length:314 Species:Anopheles gambiae


Alignment Length:295 Identity:69/295 - (23%)
Similarity:112/295 - (37%) Gaps:83/295 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLNMESAGVSAAMAGLSKSLTTPFS-INDILTR--------------SNPETRRMSSVDSEPEPE 50
            ::.|.::||...:  :|:.|..... ::.||.|              |.|   |:|:.:.|...|
Mosquito    44 IVEMAASGVRPCV--ISRQLRVSHGCVSKILNRYQETGSIRPGVIGGSKP---RVSTPEIEARIE 103

  Fly    51 KLKPSSD-------RERSISKSPPLCCRDLGLYKLTQPKEIQPSARQPSNYLQYYAAAMDNNNHH 108
            :|:.::.       |::.|...  ||           .|...||....|..|:.......:...:
Mosquito   104 ELRKANPGIFSWEIRDKLIKDG--LC-----------DKTSAPSVSSISRLLRGGRREDVDLRGN 155

  Fly   109 HQATGTSNSSAADYMQRKLAYFGSTLAAPLDMRRCTSNDSDCDSPPPLSSSPSESPLSHDGSGLS 173
            |...|....|:.|                        .|||.:|.|              |..|.
Mosquito   156 HSINGILGESSCD------------------------EDSDTESEP--------------GITLK 182

  Fly   174 RK-KRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQQ 237
            || :|||..|:..|:..||..|::.:|.....|.|:|:..:|||.:|::||.|||.:. ||.:..
Mosquito   183 RKQRRSRTTFNGEQLEALEIAFSRTQYPDVYTREELAQKTKLTEARVQVWFSNRRARL-RKHMSS 246

  Fly   238 HEAALLGASKRVPVQVLVREDGSTTYAHMAAPGAG 272
            .:....||| :.|.|  ..:..:...|..|:.|:|
Mosquito   247 QQMVAFGAS-QYPSQ--FDQQAAAVAAATASSGSG 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 20/52 (38%)
AgaP_AGAP010358XP_559100.2 PAX 19..144 CDD:238076 24/117 (21%)
Homeobox 188..241 CDD:278475 20/53 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.