DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and AgaP_AGAP000190

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_310944.5 Gene:AgaP_AGAP000190 / 1272074 VectorBaseID:AGAP000190 Length:493 Species:Anopheles gambiae


Alignment Length:383 Identity:82/383 - (21%)
Similarity:128/383 - (33%) Gaps:146/383 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 QPSNYLQYYAAAMDNNNHHHQATGTSNSSAADYMQRKLAYFGSTLAAPLD-MRRCTSND-SDCDS 152
            :|...|:.:|...|...:.|  ||.::.|:.|:.|     .|...::|.: ..|...|| |.|.:
Mosquito   146 EPLEKLKLWAETGDFRENSH--TGMTSVSSIDHAQ-----MGFPASSPRNRSSRDRKNDVSRCIN 203

  Fly   153 PPPLSSSPSESPLSH-DGSGL---------------------SRKKRSRAAFSHAQVFELERRFA 195
            ...:.:....|.:|| ||:|.                     .|::|.|..|:..|:.|||:.|:
Mosquito   204 EASVKTENLSSGMSHEDGTGSVAPGTTIQQDGTDGTKNDKKNKRQRRQRTHFTSQQLHELEQTFS 268

  Fly   196 QQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQQHEAALLGASKRVPVQVLVREDGS 260
            :.||.....|.|:|....|||.:|::||:|||.|.::::..|..|                    
Mosquito   269 RNRYPDMSTREEIAMWTNLTEARVRVWFKNRRAKWRKRERNQMNA-------------------- 313

  Fly   261 TTYAHMAAPGAGHGLDPALINIYRHQLQLAYGGLPLPQMQMPF--------PYFYPQ-HKVPQPI 316
                 :||....:|                :|    ||...||        .|.|.. .|||.|:
Mosquito   314 -----IAAADFKNG----------------FG----PQFVQPFADTDTLYSSYTYNNWAKVPSPL 353

  Fly   317 PPPT--------------------------QSSSFVTASSASS---------------------S 334
            ...|                          .|:|.|.|..|.:                     |
Mosquito   354 GAKTFPWTVNPLGTSIVSTNHHQNSINCFNTSASSVAAGMAGTGTMLPASMGTGLTGTSGATGVS 418

  Fly   335 PVPIPIPGAVRP-------QRTPCPSPNGQMMSVE-------SGAESVHSAAEDVDEN 378
            |.|.|......|       ...||.:.:..:.::.       ||..|.:||:..|..:
Mosquito   419 PTPCPYTTPTNPYMYHHRAAAEPCTAMSSSIATLRLKAKQHTSGFSSPYSASSPVSRS 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 22/52 (42%)
AgaP_AGAP000190XP_310944.5 Homeobox 252..304 CDD:278475 22/51 (43%)
OAR 445..460 CDD:281777 0/14 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.