DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and AgaP_AGAP006923

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_308835.4 Gene:AgaP_AGAP006923 / 1270160 VectorBaseID:AGAP006923 Length:580 Species:Anopheles gambiae


Alignment Length:395 Identity:100/395 - (25%)
Similarity:143/395 - (36%) Gaps:132/395 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 KPSSDR-ERSISKSPP----LCCRDLGLYKLTQPKEIQPSARQPSNYL---------QYYAAAMD 103
            :|||.| .||..|..|    |..:...:|...|.::.|...:|| .||         ....||::
Mosquito   185 RPSSPRGARSGDKLFPTEVDLLSKVYAVYHHQQQQQQQQQQQQP-RYLTPSSPGTGYTTTGAALE 248

  Fly   104 ---------NNNHHHQ-----------------------------ATGTSNSSAADYMQRKLAYF 130
                     |...|||                             ......|:.:|.:...|:..
Mosquito   249 PNGVNPGTGNGQLHHQPQSPGETIDPGSDGGPEDEERTRPTIEDGGESADGSAYSDDISLTLSPS 313

  Fly   131 G---STLAAPLDMRRCTSNDSDCDSPPPLSSSPSESPLSHDGSGLSRKKRSRAAFSHAQVFELER 192
            |   :|.....|...|  ::.||...   |||...:..|..|:..|:.:|.|.||:..|:.||||
Mosquito   314 GCGKTTDLGDSDSDAC--SEDDCTQN---SSSSGRAGKSGSGAENSKSRRRRTAFTSEQLLELER 373

  Fly   193 RFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQ--IQQHEAALLGASKRVPVQVLV 255
            .|..::|||..|||::|.||:|:|.||||||||||.|.||.:  :..|     |...|       
Mosquito   374 EFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVKAGLNSH-----GLGNR------- 426

  Fly   256 REDGSTTYAHMAAPGAGHGLD----------PALINIY----RHQLQLAYGGLPLPQMQM----- 301
                       .|.|:|.|..          |..:|.:    :|| |:....|..|:.::     
Mosquito   427 -----------NASGSGTGTTGTANKIVVPIPVHVNRFAIRSQHQ-QMEKMNLVGPKAELRKADL 479

  Fly   302 ------PFPYFYPQHKVPQPIPPPTQSSSFVTASSASSSPVPIPIPGAVRP--QRTPCPSPNGQM 358
                  .|..|.....:.:.:|     |:.||.:             .|.|  |..|.||.....
Mosquito   480 GLAESGGFERFGLNKHLSKVVP-----SAEVTGN-------------RVDPAFQAAPAPSEGASK 526

  Fly   359 MSVES 363
            .|:||
Mosquito   527 SSIES 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 31/52 (60%)
AgaP_AGAP006923XP_308835.4 Homeobox 359..412 CDD:278475 31/52 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.