DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and AgaP_AGAP007058

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_308706.3 Gene:AgaP_AGAP007058 / 1270045 VectorBaseID:AGAP007058 Length:302 Species:Anopheles gambiae


Alignment Length:235 Identity:72/235 - (30%)
Similarity:104/235 - (44%) Gaps:47/235 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 PPLSSSPSESPLSHDGSGL------SRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSL 212
            ||.:|.|.:.....:.:||      .:.::.|..:|..|:.:|.|||.:.:||:.|||:|:|.||
Mosquito    84 PPCASPPKDGKYKLEDTGLRVNGKGKKMRKPRTIYSSLQLQQLNRRFQRTQYLALPERAELAASL 148

  Fly   213 RLTETQVKIWFQNRRYKTKRKQIQQHEAALLGASKRVPVQVLVREDGSTTYAHM---AAPGAG-- 272
            .||:|||||||||||.|.| |.::..:|..:|..  :|:.. ..:.|.:...|.   .|||.|  
Mosquito   149 GLTQTQVKIWFQNRRSKYK-KMMKAAQAPGVGGG--LPLGG-PNQGGHSPSQHQNMHQAPGGGSS 209

  Fly   273 -----HGLDPALINIYRHQ--------LQLAYGGLP---LPQMQMPFPYFYPQHKVPQPIPPPTQ 321
                 |.|.|.      |.        .:|:.|..|   .|..|.|.|: :..||.||..|    
Mosquito   210 SGSPSHFLPPG------HSPTPSSTPVSELSPGLSPPSQAPWEQKPPPH-WADHKPPQMAP---- 263

  Fly   322 SSSFVTASSASSSPVPIPIPGAVRPQRTPCPSPNGQMMSV 361
                 ..:.|...|...|..|...||....|..|..:::|
Mosquito   264 -----QTNHAPPQPTHAPQMGGYVPQYWYQPETNPSLLTV 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 30/52 (58%)
AgaP_AGAP007058XP_308706.3 Homeobox 114..167 CDD:278475 30/52 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.