DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and Nkx2-5

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_446103.2 Gene:Nkx2-5 / 114109 RGDID:620520 Length:319 Species:Rattus norvegicus


Alignment Length:388 Identity:117/388 - (30%)
Similarity:150/388 - (38%) Gaps:112/388 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SKSLT-TPFSINDILTRSNPETRRMSSVD------------------SEPE----PEKLKPSSDR 58
            |.:|| ||||:.|||.... :.|.:::.|                  .:||    ||...|....
  Rat     4 SPALTHTPFSVKDILNLEQ-QQRSLAAGDLSARLEATLAPASCMLAAFKPEAYSGPEAAAPGLAE 67

  Fly    59 ---ERSISKSPPLCCRDLGLYKLTQPKEIQPSARQPSNYLQYYAAAMDNNNHHHQATGTSNSSAA 120
               |...:.|||.|            ....|:|  |:.|.:.|.               ....|.
  Rat    68 LRAELGPAPSPPKC------------SPAFPTA--PTFYPRAYG---------------DPDPAK 103

  Fly   121 DYMQRKLAYFGSTLAAPLDMRRCTSNDSDCDSPPPLSSSPSESPLSHDGSGLSRKKRSRAAFSHA 185
            |....|........|..||       .::.|.        :|.|.:.      |:::.|..||.|
  Rat   104 DPRADKKELCALQKAVELD-------KAETDG--------AERPRAR------RRRKPRVLFSQA 147

  Fly   186 QVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQQHEAALLG----AS 246
            ||:||||||.||||||.|||.::|..|:||.|||||||||||||.|| |.|.....|||    .:
  Rat   148 QVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKCKR-QRQDQTLELLGPPPPPA 211

  Fly   247 KRVPVQVLVREDGSTTYAHMA--APGAGHGLDPALINIYRHQLQLAYGGL---PLPQMQMPFPYF 306
            :|:.|.|||| ||.......|  ||..|.||:....|.|.:.   .|||.   |.......:|..
  Rat   212 RRIAVPVLVR-DGKPCLGDSAAYAPAYGVGLNAYGYNAYPYP---GYGGAACSPAYSCAAAYPAA 272

  Fly   307 YPQHKVPQPIPPPTQSSSFVTASSASSSPVPIPIPGAVRPQRTPCPSPNGQMMSVESGAESVH 369
            .|   ..|| |....:|:||.......:.|..|            ..|.|     .||..::|
  Rat   273 PP---AAQP-PAAAANSNFVNFGVGDLNTVQSP------------GMPQG-----NSGVSTLH 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 38/52 (73%)
Nkx2-5NP_446103.2 Homeobox 144..194 CDD:395001 37/49 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.