DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and Prrx2

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001099209.1 Gene:Prrx2 / 113931 RGDID:1311471 Length:248 Species:Rattus norvegicus


Alignment Length:297 Identity:69/297 - (23%)
Similarity:101/297 - (34%) Gaps:122/297 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 PKEIQPSARQPSNYLQYYAAAMDNNNHHHQATGTSNSSAADYMQRKLAYFGSTLAAPLDMRRCTS 145
            |:..:.:||:||.                   |:|.|.||                        .
  Rat    58 PEAREGAAREPSG-------------------GSSGSEAA------------------------P 79

  Fly   146 NDSDCDSPPPLSSSPSESPLSHDGSGLSRKK---RSRAAFSHAQVFELERRFAQQRYLSGPERSE 207
            .|.:|.:|            .| ||...|||   |:|..|:.:|:..|||.|.:..|.....|.|
  Rat    80 QDGECAAP------------GH-GSATKRKKKQRRNRTTFNSSQLQALERVFERTHYPDAFVREE 131

  Fly   208 MAKSLRLTETQVKIWFQNRRYKTKRKQIQQHEAALLGASKRVPVQVLVREDGSTTYAHMAAPGAG 272
            :|:.:.|:|.:|::||||||.|.:|     :|.|:|.....                        
  Rat   132 LARRVNLSEARVQVWFQNRRAKFRR-----NERAMLATRSA------------------------ 167

  Fly   273 HGLDPALINIYRHQLQLAYGGLPLPQMQMPFPYFYPQHKVPQPIPP-PTQSSSFVTASSASS--S 334
                         .|..:||               .:..:.||:.| ||..|....:..|||  |
  Rat   168 -------------SLLKSYG---------------QEAAIEQPVAPRPTTLSPDYLSWPASSPYS 204

  Fly   335 PVPIPIPGAVRPQRTPCPSPNGQMMSVESGAE--SVH 369
            .||...||...| .||..:....:.|:...|:  |:|
  Rat   205 SVPPYSPGGSSP-ATPGVNMANSIASLRLKAKEFSLH 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 21/52 (40%)
Prrx2NP_001099209.1 Homeobox 104..156 CDD:395001 20/51 (39%)
COG5576 <110..214 CDD:227863 40/160 (25%)
OAR 222..238 CDD:397759 2/15 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.