DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and AgaP_AGAP013157

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_003436884.1 Gene:AgaP_AGAP013157 / 11175794 VectorBaseID:AGAP013157 Length:447 Species:Anopheles gambiae


Alignment Length:319 Identity:84/319 - (26%)
Similarity:128/319 - (40%) Gaps:61/319 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 EPEKLKPSSDRERSISKS-----PPLCCRDLGLYKLTQPKEIQPSAR----QPSNYLQY---YAA 100
            :|.:::.|:..:||..||     ||...|.:...:....::..|:.|    .|:..|:|   ||.
Mosquito    95 KPTEVERSNVEKRSCEKSCETIKPPAMKRKISEKETNDNEKDSPALRALLTNPAKKLKYNPHYAH 159

  Fly   101 AMDNNNHHH-QAT-----GTSNSSAADYMQRKLAYFG-----STLAAPLD--------------- 139
            :|.|.:... :||     |..:.:|:|.:...:....     .::.:.||               
Mosquito   160 SMTNESSRRIEATIGYNNGFLSPAASDRIVPDIVPLSPNKTDDSIDSLLDNSSKQDIVTMQCVDY 224

  Fly   140 ----MRRCTSNDS-DCDSPPPLSSSPSESPLSHDGSGLSRK---KRSRAAFSHAQVFELERRFAQ 196
                :|:.|:... |..|.||||....||.:|..|.....|   ||:|.::|..|..|||:.|..
Mosquito   225 TLNSLRQITATPKYDGVSTPPLSPKNMESAISSQGVENHPKESSKRTRQSYSRHQTIELEKEFHF 289

  Fly   197 QRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQQHEAALLGASKRVPVQVLVREDGST 261
            .|||:...|.|:|..|:|||.|:||||||||.|.|:..........|.....:|.|.|.......
Mosquito   290 NRYLNRRRRIEIASMLKLTERQIKIWFQNRRMKAKKDNSASANTPDLTYDGEIPQQSLESIVAVQ 354

  Fly   262 TYAHMAAPGAGHGLDPALIN---------IYRHQLQLAYGGLPLPQMQMPF-PYFYPQH 310
            :..|.|:..     .|..:|         :.||..|....|...|...... .|:|.|:
Mosquito   355 SQHHTASDS-----QPLSMNTSASTVTQQVGRHCDQQMMDGWSYPHSHYSHNQYYYMQN 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 27/52 (52%)
AgaP_AGAP013157XP_003436884.1 FTZ 46..249 CDD:281812 33/153 (22%)
Homeobox 271..324 CDD:278475 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.