DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and AgaP_AGAP013373

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_003436924.1 Gene:AgaP_AGAP013373 / 11175540 VectorBaseID:AGAP013373 Length:216 Species:Anopheles gambiae


Alignment Length:238 Identity:68/238 - (28%)
Similarity:104/238 - (43%) Gaps:46/238 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 SSPSESPLSHDGSGLSRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIW 222
            |:|..|.|.......:|:::.|.|:|..|:..||..|.:..||:..:|.|:|:.|.|||||:|.|
Mosquito     2 STPVASTLVKRYRKQNRERKPRQAYSAMQLERLEDEFQRNIYLNVNKRFELAQCLGLTETQIKTW 66

  Fly   223 FQNRRYKTKR------KQIQQHEAALLGASKRVPVQV-LVREDGSTTYAHMAAPGAGHGLDP--- 277
            |||||.|.|:      |:.|:.:|.|:......|.|: .:..||.              |.|   
Mosquito    67 FQNRRTKFKKQQDSRNKREQRQQAQLIAQWLFQPPQLGSIPLDGQ--------------LQPLPR 117

  Fly   278 -ALINIYRHQLQLAYGGLPLPQMQMPFPYFYPQHKVPQPIPPPTQSSSFVTASSASSSP-VPIPI 340
             |.:.::|..|.||.|.|   |..:..||    |.:| |.....|........:....| |..|:
Mosquito   118 LAALPVHRSSLALAQGTL---QSALMAPY----HLLP-PTSLTVQQHQHQQRCALEDGPRVVKPV 174

  Fly   341 -----PGAVRPQRTPCP-SPNGQMMSVESGAESVHSAAEDVDE 377
                 |.||....|..| :.:..:.|:::|      .|:|:.:
Mosquito   175 YTVRSPNAVPAFPTAVPFATSSVVSSLQTG------GAKDLQQ 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 26/52 (50%)
AgaP_AGAP013373XP_003436924.1 Homeobox 22..75 CDD:278475 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.