DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and LOC101731897

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_004913865.2 Gene:LOC101731897 / 101731897 -ID:- Length:130 Species:Xenopus tropicalis


Alignment Length:154 Identity:31/154 - (20%)
Similarity:53/154 - (34%) Gaps:49/154 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 SRKKRSRAAFSHAQVFELERR--FAQQRYLSGPERSEMAKSLR-LTETQVKIWFQNRRYKTKRKQ 234
            :|..|:...|...:|..|.|:  :|::.....|  ..:|..|. ||...:::.....|...|.:.
 Frog    17 TRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAP--VYLAAVLEYLTAEILELAGNAARDNKKTRI 79

  Fly   235 IQQHEAALLGASKRVPVQVLVREDGSTTYAHMAAPGAGHGLDPALINIYRHQLQLAYGGLPLPQM 299
            |.:|            :|:.||.|..                   :|.....:.:|.||: ||.:
 Frog    80 IPRH------------LQLAVRNDEE-------------------LNKLLGGVTIAQGGV-LPNI 112

  Fly   300 QMPFPYFYPQHKVPQPIPPPTQSS 323
            |...            :|..|:||
 Frog   113 QSVL------------LPKKTESS 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 11/55 (20%)
LOC101731897XP_004913865.2 PTZ00017 1..130 CDD:185399 31/154 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.