DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and LOC101731251

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_017951762.1 Gene:LOC101731251 / 101731251 -ID:- Length:882 Species:Xenopus tropicalis


Alignment Length:176 Identity:35/176 - (19%)
Similarity:64/176 - (36%) Gaps:55/176 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 LQYYAAAMDNNNHHHQATGTSNSSAADYMQRKLAYFGSTLAAPLDMRRCT-----SNDSDCDSPP 154
            |.|:.:.::.:......|.|..:  |.|:::...|          :.|||     .|:.|.:...
 Frog   639 LTYFLSLVNMDIEELDLTATQVN--AQYLKQLQPY----------LNRCTRLWMGENNLDTEMIT 691

  Fly   155 PLSSSPSESPLSHDGSGLSRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQV 219
            .:.|. .|||                   ..|:.:|...:||   |...|..::.|:|:..:|.:
 Frog   692 VICSL-LESP-------------------DCQIKQLGLGWAQ---LEDEEFLQLYKALKNNKTLI 733

  Fly   220 KIWFQNRRYKTKRKQIQQ-----------HEAALLGASKRVPVQVL 254
            ::|.:.....:  :.|:|           ....|||  .|:|.|.|
 Frog   734 QLWVEGNNISS--EAIEQFSDIPLFTTSLQHVILLG--NRIPAQRL 775

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 10/52 (19%)
LOC101731251XP_017951762.1 DD 27..105 CDD:387368
FISNA 123..196 CDD:373091
P-loop_NTPase 208..373 CDD:393355
NOD2_WH 449..506 CDD:375327
NLRC4_HD2 508..609 CDD:375325
LRR_RI <618..>770 CDD:393385 31/169 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.