Sequence 1: | NP_732637.1 | Gene: | bap / 42537 | FlyBaseID: | FBgn0004862 | Length: | 382 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_003689019.1 | Gene: | Rhox4a2 / 100861640 | MGIID: | 5434453 | Length: | 205 | Species: | Mus musculus |
Alignment Length: | 197 | Identity: | 46/197 - (23%) |
---|---|---|---|
Similarity: | 75/197 - (38%) | Gaps: | 41/197 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 90 QPSNYLQYYAAAMDNNNHHHQAT------------------GTSNSSAAD-YMQRKLAYFGSTLA 135
Fly 136 APLD-MRRCTSNDSDCDSPPPLSSSPSESPLSHDG-------------SGLSRK-----KRS-RA 180
Fly 181 AFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRR--YKTKRKQIQQHEAALL 243
Fly 244 GA 245 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
bap | NP_732637.1 | Homeobox | 178..231 | CDD:278475 | 19/55 (35%) |
Rhox4a2 | XP_003689019.1 | P-loop_NTPase | 41..>126 | CDD:393355 | 16/84 (19%) |
homeodomain | 129..187 | CDD:238039 | 20/57 (35%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |