DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and Rhox4a2

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_003689019.1 Gene:Rhox4a2 / 100861640 MGIID:5434453 Length:205 Species:Mus musculus


Alignment Length:197 Identity:46/197 - (23%)
Similarity:75/197 - (38%) Gaps:41/197 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 QPSNYLQYYAAAMDNNNHHHQAT------------------GTSNSSAAD-YMQRKLAYFGSTLA 135
            |.:|||.:.....|..|.:...|                  |.|.::|.: ....:|:..|...|
Mouse     4 QNTNYLLHEGLGKDKENLNGGKTQAVLPLDGEGRNEGESVLGQSGAAAVEGDKAEELSGEGGPAA 68

  Fly   136 APLD-MRRCTSNDSDCDSPPPLSSSPSESPLSHDG-------------SGLSRK-----KRS-RA 180
            ...| |......|.|............|.|:..|.             ||:..|     :|| ..
Mouse    69 GDADLMDNSNQEDQDTSGSAQEEEKLPEEPVLKDAVVIDKVQPIPVLVSGVRPKSVWVQQRSLHY 133

  Fly   181 AFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRR--YKTKRKQIQQHEAALL 243
            .|...|:.||||.|.|..::...||..:|:.:.::|.:||.||:.||  ::..:.|:..::.|.:
Mouse   134 NFQWWQLQELERIFQQNHFIRAEERRHLARWIGVSEARVKRWFKKRREHFRRGQSQLGMNDDASV 198

  Fly   244 GA 245
            |:
Mouse   199 GS 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 19/55 (35%)
Rhox4a2XP_003689019.1 P-loop_NTPase 41..>126 CDD:393355 16/84 (19%)
homeodomain 129..187 CDD:238039 20/57 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.