DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and evx2

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_002935724.3 Gene:evx2 / 100498260 XenbaseID:XB-GENE-852923 Length:502 Species:Xenopus tropicalis


Alignment Length:329 Identity:74/329 - (22%)
Similarity:119/329 - (36%) Gaps:94/329 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 FSINDILTRSNPETRRMSSVDSEPEPEKLK--PSSDRERSISKSPPLCCRDLGLYKLTQPKEIQP 86
            |.|..:...|:........:......:||.  |...:|..::....:.|..|             
 Frog   150 FEIESLFGISHSTEESNGDISGADRGKKLSQYPEVSKEADMNSDVEVGCAGL------------- 201

  Fly    87 SARQPSNYLQYYAAAMDNNNHHHQATGTSNSSAADYMQRKLAYFGSTLAAPLDMRRCTSNDSDCD 151
              |.|.:.         |.|...:::..|.||.|.                      |:..|   
 Frog   202 --RSPGSI---------NGNQLKESSKDSGSSVAS----------------------TTGSS--- 230

  Fly   152 SPPPLSSSPSESPLSHDGSGLSRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTE 216
            :|..:.|....:|:....|...:.:|.|.||:..|:..||:.|.::.|:|.|.|.|:|.:|.|.|
 Frog   231 TPSGIGSLNGLNPVGSSSSAADQVRRYRTAFTREQIGRLEKEFYRENYVSRPRRCELAAALNLPE 295

  Fly   217 TQVKIWFQNRRYKTKRKQIQQHEAALLGASKRVPVQVLVREDGSTTYAHMAAPGAGHGLDPALIN 281
            |.:|:||||||.|.||:::.                             |:.|   |..||:...
 Frog   296 TTIKVWFQNRRMKDKRQRLA-----------------------------MSWP---HPADPSFYT 328

  Fly   282 IYRHQLQLAYGGLPLP-QMQMPFPYFYPQHKVPQPIPPPTQSSSFVTASSASSSPVPIPIPGAVR 345
             |......|.|.||.| ...:|. ::||...|       |.:::...||.|:::... |...::|
 Frog   329 -YMMTHAAATGSLPYPFHSHVPL-HYYPHVGV-------TAAAAAAAASGAAAAAAS-PFATSIR 383

  Fly   346 PQRT 349
            |..|
 Frog   384 PLDT 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 25/52 (48%)
evx2XP_002935724.3 Homeobox 258..311 CDD:395001 25/52 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.