DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and nkx3-2

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_002940787.1 Gene:nkx3-2 / 100497965 XenbaseID:XB-GENE-876834 Length:329 Species:Xenopus tropicalis


Alignment Length:318 Identity:113/318 - (35%)
Similarity:139/318 - (43%) Gaps:91/318 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SKSLTTPFSINDILTRSNPETRRMSSVDSEPEPEKLKPSSDRERSISKSPPLCCRDL-------G 74
            |....|||||..||.|.....|....:.|               ::|   |.||..:       |
 Frog    61 SSGSLTPFSIQAILNRKEERARTFPRLGS---------------AVS---PACCWRIFGETEADG 107

  Fly    75 LYKLTQPKEIQPSARQPSNYLQYYAAAMDNNNHHHQATGTSNSSAADYMQRKLAYFGST----LA 135
            |..|........:..:|:.:                     :|.:|...:.:|...|.|    ..
 Frog   108 LGSLCGGTPGTGAGGEPAGW---------------------DSDSALSEEGELGRPGDTGERKKQ 151

  Fly   136 APLDMR------RCTSNDSDCD----SPPPLSSSPSESPLSHD---GSGLSRKKRSRAAFSHAQV 187
            .||:.|      ..|...|||:    .|.|  |.|.|.|....   .....||||||||||||||
 Frog   152 RPLEARTKGEDEEETPGCSDCEIGAGVPDP--SPPDEDPKCEQLMLEPPKQRKKRSRAAFSHAQV 214

  Fly   188 FELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQQHEAALLGASKRVPVQ 252
            |||||||..|||||||||:::|.||:|||||||||||||||||||:|:.....|...|:|:|.|:
 Frog   215 FELERRFNHQRYLSGPERADLAASLKLTETQVKIWFQNRRYKTKRRQMAADLLAAAPAAKKVAVK 279

  Fly   253 VLVREDGSTTYAHMAAPGAGHGLDPALINIYRHQLQLAYGGLPLPQMQMPFPYFYPQH 310
            ||||:| ...|.      .|..|.|:|              |||..     |||||.:
 Frog   280 VLVRDD-QRQYQ------PGEVLRPSL--------------LPLQT-----PYFYPYY 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 45/52 (87%)
nkx3-2XP_002940787.1 Homeobox 205..259 CDD:365835 46/53 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 105 1.000 Domainoid score I6576
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003099
OrthoInspector 1 1.000 - - otm49085
Panther 1 1.100 - - O PTHR24340
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4480
SonicParanoid 1 1.000 - - X4759
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.040

Return to query results.
Submit another query.