DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and barhl2

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_012817899.1 Gene:barhl2 / 100493839 XenbaseID:XB-GENE-482777 Length:359 Species:Xenopus tropicalis


Alignment Length:336 Identity:82/336 - (24%)
Similarity:113/336 - (33%) Gaps:120/336 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 KSLTTPFSINDILTRSNPETRRMSSVDSEPEPEKLKPSSDRERSISKSPPLCCRDLGLYKLTQPK 82
            ::.|:.|.|.|||..|.|.........:.|.|...........|.|..|          ||.|  
 Frog   105 RTSTSSFLIKDILGDSKPLAACAPYSTTVPSPHHTPKHEGNGSSESFRP----------KLEQ-- 157

  Fly    83 EIQPSARQPSNYLQYYAAAMDNNNHHHQATGTSNSSAADYMQRKLAYFGSTLAAPLDMRRCTSND 147
            |:|....:         |.....:.|....|.......|                   |..||:.
 Frog   158 EMQDGKGK---------AEKIREDLHTDIKGHGTKEEGD-------------------REITSSR 194

  Fly   148 SDCDSPPPLSSSPSESPLSHDGSGLSRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSL 212
               :|||..:..|               :::|.|||..|:.:|||.|.:|:|||..:|.::|.:|
 Frog   195 ---ESPPVRAKKP---------------RKARTAFSDHQLNQLERSFERQKYLSVQDRMDLAAAL 241

  Fly   213 RLTETQVKIWFQNRRYKTKRKQIQQHEAALLGASKRVPVQVLVREDGSTTYAHMAAPGAGHGLDP 277
            .||:||||.|:||||.|.||:.....|              |:.|.|:                 
 Frog   242 NLTDTQVKTWYQNRRTKWKRQTAVGLE--------------LLAEAGN----------------- 275

  Fly   278 ALINIYRHQLQLAYGGLPLPQMQMPFPYFYPQHKVPQPIPPPTQSSSFVTASSASSS-------P 335
                         |..|   |...|.||||  |      |....|....||::|:::       .
 Frog   276 -------------YSAL---QRMFPSPYFY--H------PSLLSSMDSTTAAAAAAAMYSSMYRT 316

  Fly   336 VPIPIPGAVRP 346
            .|.|.|...||
 Frog   317 PPAPHPQLQRP 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 28/52 (54%)
barhl2XP_012817899.1 Homeobox 208..261 CDD:365835 28/52 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.