DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and pdx1

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_002934065.1 Gene:pdx1 / 100490648 XenbaseID:XB-GENE-483331 Length:271 Species:Xenopus tropicalis


Alignment Length:331 Identity:76/331 - (22%)
Similarity:125/331 - (37%) Gaps:108/331 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RRMSSVDSEPEPEKLKPS---SDRERSISKSPPLCCRDLGLYKLTQPKEIQPSARQP-SNYLQYY 98
            :|..:.|..|.|    |:   ..|::..:.|.||...|.|......|.|:.|.:.:| ..:|.::
 Frog    21 QRSQAQDYNPSP----PACLYMGRQQQAAYSNPLVALDPGSPPDISPYEVPPISEEPIVPHLHHH 81

  Fly    99 AAAMDNNNHHHQATGTSNSSAADYMQRKLAYFGSTLAAPLDMRRCTSNDSDCDSPPPLSSSP-SE 162
                 :::|||...|      ..:..:::.:...|.:|.|:.|..|           |...| .:
 Frog    82 -----HHHHHHHHPG------IPHPHQQMPFPDDTESATLEERNRT-----------LLPFPWMK 124

  Fly   163 SPLSHDGSG----------LSRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTET 217
            |..||...|          ....||:|.|::.||:.|||:.|...:|:|.|.|.|:|..|.|||.
 Frog   125 STKSHTWKGQWTGGSYIMEQEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTER 189

  Fly   218 QVKIWFQNRRYKTKRKQIQQHEAALLGASKRVPVQVLVREDGSTTYAHMAAPGAGHGLDP----- 277
            .:||||||||.|.|:::.::.                                 |.|.||     
 Frog   190 HIKIWFQNRRMKWKKEEDKKR---------------------------------GRGSDPEQDSV 221

  Fly   278 -ALINIYRHQLQLAYGGLPLPQMQMPFPYFYPQHKVPQPIPPPTQSSSFVTASSASSSPV--PIP 339
             :..::.:.:                          ||.:.....:...|.:|:..:||.  |||
 Frog   222 VSSADVIKDE--------------------------PQCLGNSQNTGDLVRSSALPTSPQSNPIP 260

  Fly   340 IPGAVR 345
            ..|::|
 Frog   261 ATGSLR 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 27/52 (52%)
pdx1XP_002934065.1 Homeobox 150..204 CDD:365835 27/53 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.