DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and arx

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_002933659.1 Gene:arx / 100486727 XenbaseID:XB-GENE-483940 Length:536 Species:Xenopus tropicalis


Alignment Length:378 Identity:90/378 - (23%)
Similarity:133/378 - (35%) Gaps:136/378 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 LKPSSDRERSISK-------SPPLCCRD---LGLYKLTQPKEIQPSARQPSNYLQYYAAAM---- 102
            ||.|...:.|||:       |.||...:   .||.:.:| ::||.||......||....|:    
 Frog   131 LKISQAPQVSISRSKSYRENSAPLLREEHSPEGLLQQSQ-QQIQTSATTACTSLQDRLGALSQSP 194

  Fly   103 --------------------DNNNHHHQATGTSNSSAADYMQRKLAYFGSTLAAPLDMRRCTSND 147
                                |..|..|....:||.:.|...:::...|             .|..
 Frog   195 RDEDDDDEEDEDEEEEEEEEDEANKQHNPNNSSNPNRAHLQEQQHPQF-------------QSQQ 246

  Fly   148 SDCDSPPP-----LSSSPSESPLSH--DGSG-------------------LSRK-KRSRAAFSHA 185
            |....|||     ...||.|..:.|  |..|                   |.|| :|.|..|:..
 Frog   247 SQQQQPPPGCGTDAELSPKEELMLHSSDADGKDGEDSVCLSAGSDSEEGMLKRKQRRYRTTFTSY 311

  Fly   186 QVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQQHEAALLGASKRVP 250
            |:.||||.|.:..|.....|.|:|..|.|||.:|::||||||.|.::::                
 Frog   312 QLEELERAFQKTHYPDVFTREELAMRLDLTEARVQVWFQNRRAKWRKRE---------------- 360

  Fly   251 VQVLVREDGSTTYA-HMAAPG---AGHGLDPALINIYRHQLQLAYGGLPLPQMQMPFPYFYPQHK 311
                  :.|:.|:| .:..||   |.|.|.|.|                   ...|||   |.| 
 Frog   361 ------KAGAQTHAPGLPFPGPLSASHPLGPYL-------------------DASPFP---PHH- 396

  Fly   312 VPQPIPPPTQSSSFVTASSASSSPVP-IPIPGAVRPQRTPCPSPNGQMMSVES 363
                   |...|::..|::|:::..| :|.|    |..:....|:|..:.:.:
 Frog   397 -------PALDSAWTAAAAAAAAAFPSLPPP----PHGSAALPPSGSPLGLST 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 24/52 (46%)
arxXP_002933659.1 Homeobox 305..358 CDD:365835 24/52 (46%)
OAR 500..518 CDD:367680
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.