DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and shox

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_004911874.1 Gene:shox / 100486480 XenbaseID:XB-GENE-920752 Length:334 Species:Xenopus tropicalis


Alignment Length:248 Identity:67/248 - (27%)
Similarity:98/248 - (39%) Gaps:58/248 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 TGTSN--------SSAADYMQRKLAYFGSTLAAPLDMRRCTSNDSDCDSPPPLSSSPSESPLSHD 168
            |.|||        ...||..:.||..:|||..:. .:..|.....|..|.            ..|
 Frog    98 TDTSNHCPLHLYKEHGADSDKDKLKDYGSTRVSE-GIYECKEKRDDVKSE------------DED 149

  Fly   169 GSGLSRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRK 233
            |....:::|||..|:..|:.||||.|.:..|.....|.|:::.|.|:|.:|::||||||.|.:::
 Frog   150 GQTKLKQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQ 214

  Fly   234 QIQQHE---AALLGASKRVPVQVLVREDGSTTYAHMAAPGAGHGLDPALINIYRHQLQLAYGGLP 295
            :.|.|:   ..:||.             ||.......||....|   ||    |...|.....|.
 Frog   215 ENQMHKGGYGVILGT-------------GSHLETCRVAPYVNMG---AL----RMPFQQVQAQLQ 259

  Fly   296 LPQMQMPFPYFYPQHKVPQP---IPPP-----------TQSSSFVTASSASSS 334
            |..:....|:.:|......|   .|||           |.|::.|.|::|.|:
 Frog   260 LEGVAHAHPHLHPHLAAHAPYLMFPPPPFGLPIASLADTASAAAVVAAAAKSN 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 23/52 (44%)
shoxXP_004911874.1 Homeobox 159..213 CDD:365835 23/53 (43%)
OAR 314..330 CDD:367680
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.