DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and nkx2-3

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_002937234.1 Gene:nkx2-3 / 100486189 XenbaseID:XB-GENE-852996 Length:328 Species:Xenopus tropicalis


Alignment Length:389 Identity:111/389 - (28%)
Similarity:151/389 - (38%) Gaps:116/389 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 TTPFSINDILTRSNPETRRMSSVDSEPEPEKLKPSSDRERSISKSPPLCCRDLGLYKLTQPKEIQ 85
            :||||:.|||           :::.:.:|....|...:::.....|....:||           .
 Frog     9 STPFSVKDIL-----------NLEQQGQPPIAHPQHLQQQCSRAHPAHPAQDL-----------D 51

  Fly    86 PSARQPSNYLQ-----YYAAAMDNNNHHHQATGTSNSSAADYMQRKLAYFGSTLAAP------LD 139
            ...:|.|..|.     .||...|                      ||.:..:..||.      |.
 Frog    52 SDFQQASCMLAAGERCVYAGGED----------------------KLPFLSAMGAAEPHGDVGLS 94

  Fly   140 MRRCTS----NDSDCDSPPPLSSSPSESPL---SHDGSG----------LSRKKRSRAAFSHAQV 187
            ..|..:    .:.|.:....|....::|..   |.||.|          .||:| .|..||.|||
 Frog    95 PDRYVALRDPKEEDEEEEDSLREGGNKSCFLNKSPDGEGKLEDPDRPKQRSRRK-PRVLFSQAQV 158

  Fly   188 FELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQQHEAALLGA-----SK 247
            |||||||.||||||.|||..:|.||:||.|||||||||||||.||:  :|.::..:|.     .:
 Frog   159 FELERRFKQQRYLSAPEREHLANSLKLTSTQVKIWFQNRRYKCKRQ--RQDKSLEMGTHHPPPPR 221

  Fly   248 RVPVQVLVREDG----------STTYAHMAAPGAGHGLDPALINIYRHQLQLAYGGLPLPQMQMP 302
            ||.|.|||| ||          :|.|...|:|             |.:....||.....|.....
 Frog   222 RVAVPVLVR-DGKPCIGGSQSYNTAYNVTASP-------------YSYNSYPAYSYNNSPSYNTN 272

  Fly   303 FPYFYPQHKVPQPIPPPTQSSSFV---TASSASSSPVPIPIPGAVRPQRTPCPSPNGQMMSVES 363
            :...|.  .:|..: ..|.:|.||   ..|..|:||.|...||      |..|:..|.:..:.:
 Frog   273 YNCNYA--SIPSNL-HNTGTSPFVNLGNLSQISNSPQPQTHPG------TSVPACQGTLQGIRA 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 40/52 (77%)
nkx2-3XP_002937234.1 Homeobox 149..203 CDD:365835 40/53 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.