DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and LOC100486032

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_002934006.1 Gene:LOC100486032 / 100486032 -ID:- Length:255 Species:Xenopus tropicalis


Alignment Length:333 Identity:89/333 - (26%)
Similarity:129/333 - (38%) Gaps:105/333 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 TRSNPETRRMSSVDSEPEPEKLKPSSDRERSISKSPPLCCRDL----------GLYKLTQPKEIQ 85
            |..|.:..|:.::.:|..| :|.|...||:.:|:  |:....|          |||. |.|....
 Frog     4 TMENSQKFRIDALLAEERP-RLLPQECREQLLSQ--PVSVSQLFPKAGFLPLPGLYP-TAPIYHL 64

  Fly    86 PS--ARQPSNYLQYYAAAMDNNNHHHQATGTSNSSAADYMQRK--LAYFGSTLAAPLDMRRCTSN 146
            ||  |..|:.....::|...:.:.|.:|     |...::..|.  |.:.|..|.|          
 Frog    65 PSLGATHPNYPYSSFSAPPASGHEHIKA-----SLPLEHWLRAGLLLHRGPDLHA---------- 114

  Fly   147 DSDCDSPPPLSSSPSESPLSHDGSGLSRK-KRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAK 210
                      |:.|          ||..| :|.|.||:..|:.|||.:|...:|||.|:|.|:|.
 Frog   115 ----------SAQP----------GLMGKCRRPRTAFTSQQLLELENQFKANKYLSRPKRFEVAT 159

  Fly   211 SLRLTETQVKIWFQNRRYKTKR-KQIQQHEAALLGASKRVPVQVLVRED--------GSTTYAHM 266
            ||.||||||||||||||.|.|| ::.::...:..|...|...:.|.:||        |....   
 Frog   160 SLMLTETQVKIWFQNRRMKWKRSRKAKEQGPSEQGDRPRAGGKTLSKEDEEEEEDEEGDFQQ--- 221

  Fly   267 AAPGAGHGLDPALINIYRHQLQLAYGGLPLPQMQMPFPYFYPQHKVPQPIPPPTQSSSFVTASSA 331
                .|.|.|     :.||..||:|                              |..|:.:...
 Frog   222 ----EGRGTD-----MLRHGTQLSY------------------------------SPEFLCSEEE 247

  Fly   332 SSSPVPIP 339
            .::.||.|
 Frog   248 ENATVPSP 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 32/52 (62%)
LOC100486032XP_002934006.1 Homeobox 127..181 CDD:365835 32/53 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.