Sequence 1: | NP_732637.1 | Gene: | bap / 42537 | FlyBaseID: | FBgn0004862 | Length: | 382 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001280727.1 | Gene: | DUX4 / 100288687 | HGNCID: | 50800 | Length: | 424 | Species: | Homo sapiens |
Alignment Length: | 210 | Identity: | 59/210 - (28%) |
---|---|---|---|
Similarity: | 82/210 - (39%) | Gaps: | 55/210 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 176 KRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQQHEA 240
Fly 241 ALLGASKRVPVQVLVREDGSTTYAHMAAPGAGHGLDPALINIYRHQLQLAYG-GLPLPQM----- 299
Fly 300 QMPFPYFYPQHKVPQPIPPPTQSSSFVTASS--------ASSSPVP-------------IPIPGA 343
Fly 344 VR----PQRTPCPSP 354 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
bap | NP_732637.1 | Homeobox | 178..231 | CDD:278475 | 19/52 (37%) |
DUX4 | NP_001280727.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..24 | ||
Homeobox | 27..74 | CDD:306543 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 72..102 | 3/6 (50%) | |||
Homeobox | 97..149 | CDD:306543 | 19/59 (32%) | ||
DNA_pol3_gamma3 | <141..319 | CDD:331207 | 45/164 (27%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 218..362 | 15/63 (24%) | |||
Required for interaction with EP300 and CREBBP, and for transcriptional activation of target genes. /evidence=ECO:0000269|PubMed:26951377 | 327..424 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 388..414 | ||||
Important for transcriptional activation of target genes. /evidence=ECO:0000269|PubMed:29618456 | 405..424 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |