DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and ventx3.2

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001123388.1 Gene:ventx3.2 / 100170150 XenbaseID:XB-GENE-483077 Length:282 Species:Xenopus tropicalis


Alignment Length:346 Identity:83/346 - (23%)
Similarity:112/346 - (32%) Gaps:138/346 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 LKPSSDRERSISKSPPLCCR-DLGLYK-------------LTQPKEI---QPSARQPSNY----- 94
            |..||.|:       |||.. ||..||             ::.|..:   .|..|:..||     
 Frog    11 LSESSQRK-------PLCTNVDLLGYKSGNPDLPPNREYNVSLPSRVILPTPDYREKENYCGRNV 68

  Fly    95 ------------LQYYAAAMDNNNHHHQATGTSNSSAADYMQRKLAYFGSTLAAPLDMRRCTSND 147
                        |.::.|..:.......:...|..|:.|  ||.:   |.|     |..:.|.:.
 Frog    69 HNGERSPPVRDQLHFHPAPQELTTSRRTSIEVSAESSTD--QRVI---GMT-----DTNKKTKSV 123

  Fly   148 SDCDSPPPLSSSPSESPLSHDGSGLSRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSL 212
            .|.|:                      ..|:|..|:..|:.|||:.|.:.||:...|:..::|.|
 Frog   124 CDEDA----------------------ASRARTKFTAEQLEELEKSFKENRYIGSSEKRRLSKVL 166

  Fly   213 RLTETQVKIWFQNRRYKTKRKQIQQHEAALLGASKRVPVQVLVREDGSTTYAHMAAPGAGHGLDP 277
            :|:|.|:|.||||||.|.|| |.|.                                        
 Frog   167 KLSENQIKTWFQNRRMKFKR-QTQD---------------------------------------- 190

  Fly   278 ALINIYRHQLQLAYGG---LPLP--QMQMPFPYFYPQHKVPQPIPPPTQSSSFVTASSASSSPVP 337
            |.:..:...|.|.|.|   ||.|  .:|..||...||......||       |....|...||..
 Frog   191 ARVEAFFSGLYLPYYGYPDLPTPGYSVQSEFPVLAPQTMAASSIP-------FGPLHSTVMSPGL 248

  Fly   338 IP-IPGA-----------VRP 346
            .| ||.|           |||
 Frog   249 HPAIPSANLGSYPCSSMLVRP 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 23/52 (44%)
ventx3.2NP_001123388.1 Homeobox 133..186 CDD:365835 23/52 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.