DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and nkx2-1

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_002935383.1 Gene:nkx2-1 / 100135015 XenbaseID:XB-GENE-485985 Length:346 Species:Xenopus tropicalis


Alignment Length:370 Identity:107/370 - (28%)
Similarity:144/370 - (38%) Gaps:97/370 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LSKSLTTPFSINDILTRSNPETRRMSSVDSEPEPEKLKPSSDRERSISKSPPLCCRDLGLYKLTQ 80
            :|...|||||::|||:               |..|..|..:  ..|.....||.    ..|:.:|
 Frog     3 MSPKHTTPFSVSDILS---------------PLEESYKKVA--MESAGLGAPLS----AAYRQSQ 46

  Fly    81 PKEIQPSARQPSNYLQYYAAAMDNNN-----HHHQATGT---SNSSAADYMQRKLAYFGSTLAAP 137
            ..  |.|.:|         ..|.:|.     :|..|.|.   |:::...|....|...|:....|
 Frog    47 VS--QASMQQ---------HGMGHNGPVSAAYHMTAAGVPQLSHTTMGGYCNGNLGNLGNMSELP 100

  Fly   138 L---DMRRCTSNDSDCDSPPPLSSSPS-----ESPLSHDGSG-----------------LSRKKR 177
            .   .||..::......:|.|..|:.|     .|.::..|.|                 ..|:||
 Frog   101 PYQDTMRNSSATGWYGANPDPRFSTISRFMGPSSGMNMGGLGNMGSLGDVGKSMTPLQATPRRKR 165

  Fly   178 SRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKR--------KQ 234
             |..||.|||:||||||.||:|||.|||..:|..:.||.|||||||||.|||.||        :|
 Frog   166 -RVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQQ 229

  Fly   235 IQQHEAAL--LGASKRVPVQVLVREDGSTTYAHMAAPGAGHGLDPALINIYRHQLQLA------Y 291
            :||..::.  ..:.:||.|.|||: ||....|....|.|.         :..||.|.|      .
 Frog   230 MQQDNSSCQQQQSPRRVAVPVLVK-DGKPCQAGSNTPTAA---------LQSHQQQTATAITVTS 284

  Fly   292 GGLPLPQMQM-----PFPYFYPQHKVPQPIPPPTQSSSFVTASSA 331
            .||...|...     ..|...|....|..:.....|.|.:.:||:
 Frog   285 NGLGPHQSHQTNSAGQSPDLVPHSNSPSSLQNQVTSLSHLNSSSS 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 35/52 (67%)
nkx2-1XP_002935383.1 Homeobox 165..219 CDD:365835 36/54 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.