DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and nkx3-1

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_012814889.1 Gene:nkx3-1 / 100038192 XenbaseID:XB-GENE-479027 Length:211 Species:Xenopus tropicalis


Alignment Length:225 Identity:80/225 - (35%)
Similarity:106/225 - (47%) Gaps:76/225 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SKSLTTP------FSINDILTRSNPETRRMSSVDSEPEPEKLKPSSDRERSISKSPPLCCRDLGL 75
            ::.|:.|      |.|.|||:...| .|:..|:||        |.:|:::..|         ||.
 Frog     6 TEDLSLPAKPLKSFLIQDILSHIGP-GRKEKSLDS--------PKTDQDQDSS---------LGG 52

  Fly    76 YKLTQPKEIQPSARQPSNYLQYYAAAMDNNNHHHQATGTSNSSAADYMQRKLAYFGSTLAAPLDM 140
            .|.....|.|.|:.||:..            ||.|                              
 Frog    53 KKENCTPEKQQSSSQPAEM------------HHSQ------------------------------ 75

  Fly   141 RRCTSNDSDCDSPPPLSSSPSESPLSHDGSGLSRKKRSRAAFSHAQVFELERRFAQQRYLSGPER 205
              ....:.:.|...|:  ||.|..|.      .::|||||||||:||.||||:|:.|:|||.|||
 Frog    76 --MEDENVELDQAQPI--SPVEKKLK------LQQKRSRAAFSHSQVIELERKFSSQKYLSAPER 130

  Fly   206 SEMAKSLRLTETQVKIWFQNRRYKTKRKQI 235
            :::||||:|||||||||||||||||||||:
 Frog   131 AQLAKSLKLTETQVKIWFQNRRYKTKRKQL 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 41/52 (79%)
nkx3-1XP_012814889.1 Homeobox 103..157 CDD:365835 42/53 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003099
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24340
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4480
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.130

Return to query results.
Submit another query.