DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and not

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001164669.1 Gene:not / 100038059 XenbaseID:XB-GENE-478518 Length:236 Species:Xenopus tropicalis


Alignment Length:248 Identity:69/248 - (27%)
Similarity:103/248 - (41%) Gaps:78/248 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 AMAGLSKSLTTP---FSINDILTRSNPETRRMSSVDSE-PEPEKLKPSSDRER---SISKSPPLC 69
            ||:..|:...||   |:|:.||:|::   |.:..|..| |..:...|.|...|   .:...||:.
 Frog    19 AMSISSELPRTPKASFNIDSILSRAD---RPVPKVSMEMPSWQPPSPPSVPYRYSYGMMPYPPVW 80

  Fly    70 CRDLGLYKLTQPKEIQPSARQPSNYLQYYAAAMDNNNHHHQATGTSNSSAADYMQRKLAYFGSTL 134
            .             |:|:...||...|                                      
 Frog    81 L-------------IKPTVGYPSMAQQ-------------------------------------- 94

  Fly   135 AAPLDMRRCTSNDSDCDSPPP--------LSSSP--SESPLSHDGSGLSRKKRSRAAFSHAQVFE 189
             .|:.|.|     .:|..|.|        .|..|  |.:|||. .:|..:.||.|..|:..|:..
 Frog    95 -QPMRMPR-----GECPCPDPACKERGLLYSHCPNGSMNPLSW-RTGPCKMKRIRTVFTPEQLER 152

  Fly   190 LERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQQHEAAL 242
            ||:.|.:|:|:.|.||.::|.:|.|||||||:||||||.|.:::.::|.:|.|
 Frog   153 LEKEFLKQQYMVGTERVDLASTLNLTETQVKVWFQNRRIKWRKQSLEQKKAKL 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 27/52 (52%)
notNP_001164669.1 Homeobox 142..194 CDD:278475 27/51 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.