DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and LOC100008066

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_003199819.1 Gene:LOC100008066 / 100008066 -ID:- Length:251 Species:Danio rerio


Alignment Length:238 Identity:63/238 - (26%)
Similarity:103/238 - (43%) Gaps:53/238 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SKSLTTP--FSINDILTRSNPETRRMSSVDSEPE---PEKLKPSSDRERSISKS--PPLCCRDLG 74
            ||:...|  |.|:.||..:.||:.|:.|.:..|.   |......|.|...:|.:  |.      |
Zfish    10 SKAHQEPIRFGIDQILGSAEPESSRLGSPNIAPHVPLPGVSLEESGRVFGVSSALLPG------G 68

  Fly    75 LYKLTQPKEIQPSARQPSNYLQYYAAAMDNNNHHHQATGTSNSSAADYMQRKLAYFGSTLAAPLD 139
            :.::...:.:.|:....:..|.:  ..||||                   |:..........|..
Zfish    69 VIRVPAHRPLAPAMMSAAPALCF--PWMDNN-------------------RRFPKDRLPALIPFT 112

  Fly   140 MRRCTSNDSDCDSPPPLSSSPSESPLSHDGSGLSRKKRSRAAFSHAQVFELERRFAQQRYLSGPE 204
            :.|...:.....:||                   ::|:.|.:||..|:.|||:||.:|:||:..|
Zfish   113 VTRRIGHPYQNRTPP-------------------KRKKPRTSFSRVQICELEKRFHRQKYLASAE 158

  Fly   205 RSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQQHEAALLGASK 247
            |:.:||||::|:.|||.||||||.|.:|:..::.||....|::
Zfish   159 RAALAKSLKMTDAQVKTWFQNRRTKWRRQTAEEREAGRQQANR 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 29/52 (56%)
LOC100008066XP_003199819.1 Homeobox 132..185 CDD:278475 29/52 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.