DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and cdx1b

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001092232.1 Gene:cdx1b / 100004956 ZFINID:ZDB-GENE-070615-29 Length:255 Species:Danio rerio


Alignment Length:322 Identity:72/322 - (22%)
Similarity:111/322 - (34%) Gaps:120/322 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 PSSDRERSISKSPPLCCRDLGLYKLTQPKEIQPSARQPSNYLQY-YAAAMDNNNHHHQATGTSNS 117
            |:|.|..|::               ..|:...|:..|..::..| :...:..|:.||..||:.|.
Zfish    15 PNSVRHPSLN---------------LNPQNFVPAPPQYPDFTGYHHVPGITTNDPHHSQTGSWNP 64

  Fly   118 SAADYMQRKLAYF-GSTLAAPLDMRRCTSNDSDCDSPPPLSS------------------SPSES 163
            :.....:....|. ||.:::       :|......|||..||                  ||:..
Zfish    65 AYPPPREEWTPYGPGSGVSS-------SSTGQLGFSPPEFSSVQTPGLLQSSINSSVGQLSPNAQ 122

  Fly   164 ------------PLSHDGSGLSRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTE 216
                        |.:..|.....|.:.|..::..|..|||:.|...||::...::|:|.:|.|:|
Zfish   123 RRNPYDWMRRSVPPASSGGKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKAELATALSLSE 187

  Fly   217 TQVKIWFQNRRYKTK---RKQIQQHEAALLGASKRVPVQVLVREDGSTTYAHMAAPGAGHGLDPA 278
            .||||||||||.|.:   :|::||.:.|                  |||                
Zfish   188 RQVKIWFQNRRAKERKINKKKMQQPQPA------------------STT---------------- 218

  Fly   279 LINIYRHQLQLAYGGLPLPQMQMPFPYFYPQHKVPQPIPPPTQSSSFVTASSASSSPVPIPI 340
                           .|.|          |...:|..:|..|.|||    ....|.|:|:.|
Zfish   219 ---------------TPTP----------PGSALPGNVPMVTSSSS----GGLVSPPMPMSI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 24/52 (46%)
cdx1bNP_001092232.1 Caudal_act 13..132 CDD:282574 25/138 (18%)
Homeobox 150..202 CDD:278475 24/51 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.