DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tin and HDG11

DIOPT Version :9

Sequence 1:NP_524433.1 Gene:tin / 42536 FlyBaseID:FBgn0004110 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_177479.1 Gene:HDG11 / 843671 AraportID:AT1G73360 Length:722 Species:Arabidopsis thaliana


Alignment Length:154 Identity:37/154 - (24%)
Similarity:64/154 - (41%) Gaps:29/154 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   284 SGNSNPGSNSGS-------TKPRMKRKPRVLFSQAQVLELECRFRLKKYLTGAEREIIAQKLNLS 341
            ||:.:.|...||       |..:.||..|  .:..|:..||..|:...:....:|..::::|.|:
plant    10 SGSGSGGDGGGSHHHDGSETDRKKKRYHR--HTAQQIQRLESSFKECPHPDEKQRNQLSRELGLA 72

  Fly   342 ATQVKIWFQNRR--------------YKSKRGDIDCEGIAKHLKLKSEPLDSPTSLPPPIPNHVM 392
            ..|:|.||||||              .|::...|.||.||....||.  ...|....||:..   
plant    73 PRQIKFWFQNRRTQLKAQHERADNSALKAENDKIRCENIAIREALKH--AICPNCGGPPVSE--- 132

  Fly   393 WPPTMQQSQQQQQHHAQQQQMQHM 416
             .|...:.:.:.::...:::::.|
plant   133 -DPYFDEQKLRIENAHLREELERM 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tinNP_524433.1 HOX 301..357 CDD:197696 19/69 (28%)
HDG11NP_177479.1 Homeobox 35..88 CDD:278475 17/54 (31%)
START_ArGLABRA2_like 231..456 CDD:176884
SRPBCC 517..>562 CDD:301327
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.