DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tin and HB18

DIOPT Version :9

Sequence 1:NP_524433.1 Gene:tin / 42536 FlyBaseID:FBgn0004110 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_177248.3 Gene:HB18 / 843431 AraportID:AT1G70920 Length:206 Species:Arabidopsis thaliana


Alignment Length:134 Identity:41/134 - (30%)
Similarity:64/134 - (47%) Gaps:16/134 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 METASNSSSLR---SI--------YGSDEGAKKKDNSQVTSSRSELRKNSISGNSNPGSNSGSTK 297
            |..:.|||||.   ||        .|...|.:..|.:| |....|.|:..|....:...:..::.
plant     1 MALSPNSSSLDLTISIPSFSPSPSLGDHHGMRDFDINQ-TPKTEEDREWMIGATPHVNEDDSNSG 64

  Fly   298 PRMKRKPRVLFSQAQVLELECRFRLKKYLTGAEREIIAQKLNLSATQVKIWFQNRRYKS--KRGD 360
            .|.::|.|:...|:.:||..  |.....||..:::.:|..|.||..||::||||||.:|  |..:
plant    65 GRRRKKLRLTKEQSHLLEES--FIQNHTLTPKQKKDLATFLKLSQRQVEVWFQNRRARSKLKHTE 127

  Fly   361 IDCE 364
            ::||
plant   128 MECE 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tinNP_524433.1 HOX 301..357 CDD:197696 21/57 (37%)
HB18NP_177248.3 HOX 66..122 CDD:197696 21/57 (37%)
HALZ 124..167 CDD:420073 3/8 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.