DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tin and AtHB23

DIOPT Version :9

Sequence 1:NP_524433.1 Gene:tin / 42536 FlyBaseID:FBgn0004110 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_564268.1 Gene:AtHB23 / 839587 AraportID:AT1G26960 Length:255 Species:Arabidopsis thaliana


Alignment Length:183 Identity:44/183 - (24%)
Similarity:69/183 - (37%) Gaps:62/183 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 SNPGSNSGSTKPRMKRKPRVLFSQAQVLELECRFRLKKYLTGAEREIIAQKLNLSATQVKIWFQN 351
            |:.||..|..|.|:        :..|:..||..|.|...|....:..:|:.|.|...|:.|||||
plant    62 SDDGSKMGEKKRRL--------NMEQLKALEKDFELGNKLESDRKLELARALGLQPRQIAIWFQN 118

  Fly   352 RRYKSKRGDID---------CEGI---------------AKHLKLKS-EPLDSPTSL-------- 383
            ||.:||...::         .|.:               |:.:.||| ||::| .:|        
plant   119 RRARSKTKQLEKDYDMLKRQFESLRDENEVLQTQNQKLQAQVMALKSREPIES-INLNKETEGSC 182

  Fly   384 ------------PPPIPNH--VMWPPT------MQQSQQQQQHHAQQQQMQHM 416
                        ||.|.:.  :..|||      .|.|..:|:...::..:.:|
plant   183 SDRSENISGDIRPPEIDSQFALGHPPTTTTMQFFQNSSSEQRMVKEENSISNM 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tinNP_524433.1 HOX 301..357 CDD:197696 17/55 (31%)
AtHB23NP_564268.1 HOX 71..124 CDD:197696 19/60 (32%)
HALZ 126..168 CDD:396657 5/41 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 73 1.000 Inparanoid score I2435
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.