DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tin and HB52

DIOPT Version :10

Sequence 1:NP_524433.1 Gene:tin / 42536 FlyBaseID:FBgn0004110 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_200209.1 Gene:HB52 / 835481 AraportID:AT5G53980 Length:156 Species:Arabidopsis thaliana


Alignment Length:84 Identity:25/84 - (29%)
Similarity:42/84 - (50%) Gaps:8/84 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   292 NSGSTKPRMKRKPRVLFSQAQVLELECRFRLKKYLTGAEREIIAQKLNLSATQVKIWFQNRRYKS 356
            ||.|.....|::    .:|.||.:||..|.:.|.|....:..::.:|.|...||.:||||:|.:.
plant     3 NSQSQGKNKKKR----LTQDQVRQLEKCFTMNKKLEPDLKLQLSNQLGLPQRQVAVWFQNKRARF 63

  Fly   357 KRGDIDCEGIAKHLKLKSE 375
            |...::    .:|..|:|:
plant    64 KTQSLE----VQHCTLQSK 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tinNP_524433.1 Homeodomain 302..358 CDD:459649 17/55 (31%)
HB52NP_200209.1 Homeodomain 11..64 CDD:459649 18/56 (32%)

Return to query results.
Submit another query.