DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tin and HAT2

DIOPT Version :9

Sequence 1:NP_524433.1 Gene:tin / 42536 FlyBaseID:FBgn0004110 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_199548.1 Gene:HAT2 / 834784 AraportID:AT5G47370 Length:283 Species:Arabidopsis thaliana


Alignment Length:202 Identity:59/202 - (29%)
Similarity:94/202 - (46%) Gaps:30/202 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 TPSPTLDLNSSAEVDSLQAPTQKLC-----VNPLSQRLMETASNSSSLR-SIYGSDEGAKKKDNS 269
            |..||.||.   ::|....|:...|     |:..:..:..|.|...|.| .|.|:..|: ..|:.
plant    45 TFDPTSDLR---KIDVNSFPSTVNCEEDTGVSSPNSTISSTISGKRSEREGISGTGVGS-GDDHD 105

  Fly   270 QVTSSRSELRKNSISGNSNPGSNSGSTKPRMKRKPRVLFSQAQVLELECRFRLKKYLTGAEREII 334
            ::|..|...|     |.|:...:.|.|.   ::|.|:  |:.|...||..|:....|...::..:
plant   106 EITPDRGYSR-----GTSDEEEDGGETS---RKKLRL--SKDQSAFLEETFKEHNTLNPKQKLAL 160

  Fly   335 AQKLNLSATQVKIWFQNR--RYKSKRGDIDCEGIAK--------HLKLKSEPLDSPTSLPPPIPN 389
            |:||||:|.||::|||||  |.|.|:.::|||.:.:        :.:|:.|.::..|....|...
plant   161 AKKLNLTARQVEVWFQNRRARTKLKQTEVDCEYLKRCVEKLTEENRRLQKEAMELRTLKLSPQFY 225

  Fly   390 HVMWPPT 396
            ..|.|||
plant   226 GQMTPPT 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tinNP_524433.1 HOX 301..357 CDD:197696 23/57 (40%)
HAT2NP_199548.1 HD-ZIP_N 8..91 CDD:398351 12/48 (25%)
HOX 129..183 CDD:197696 22/55 (40%)
HALZ 185..228 CDD:128634 8/42 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.