DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tin and HAT22

DIOPT Version :9

Sequence 1:NP_524433.1 Gene:tin / 42536 FlyBaseID:FBgn0004110 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_195493.1 Gene:HAT22 / 829935 AraportID:AT4G37790 Length:278 Species:Arabidopsis thaliana


Alignment Length:250 Identity:60/250 - (24%)
Similarity:100/250 - (40%) Gaps:64/250 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 TPATYNYNYAGSGEVYGGATPSAVGIKSEYIPTPYVTPSPTLDLNSSAEVDSLQAPT---QKLCV 236
            :|...|||:             |:...|..:...::...|:|.|:.|.|...::...   .::| 
plant    18 SPTPNNYNH-------------AIKKSSSTVDHRFIRLDPSLTLSLSGESYKIKTGAGAGDQIC- 68

  Fly   237 NPLSQRLMETASNS--SSL--------RSIYGSDEGAKKKDNSQVTSSRSELRKNSISGNSNPGS 291
                   .:|:|:|  ||.        |.|.|.|    .::.::.|:.|....:.|...:...|.
plant    69 -------RQTSSHSGISSFSSGRVKREREISGGD----GEEEAEETTERVVCSRVSDDHDDEEGV 122

  Fly   292 NSGSTKPRMKRKPRVLFSQAQVLELECRFRLKKYLTGAEREIIAQKLNLSATQVKIWFQNR--RY 354
            ::        ||...|..|...| ||..|:|...|...:::.:|::|||...||::|||||  |.
plant   123 SA--------RKKLRLTKQQSAL-LEDNFKLHSTLNPKQKQALARQLNLRPRQVEVWFQNRRART 178

  Fly   355 KSKRGDIDCEGIAKHLK---------------LKSEPLDSPTSLPPPIPNHVMWP 394
            |.|:.::|||.:.|..:               ||:..|..|..:..|.....|.|
plant   179 KLKQTEVDCEFLKKCCETLTDENRRLQKELQDLKALKLSQPFYMHMPAATLTMCP 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tinNP_524433.1 HOX 301..357 CDD:197696 23/57 (40%)
HAT22NP_195493.1 Homeobox 129..179 CDD:278475 20/50 (40%)
HALZ 181..224 CDD:128634 9/42 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.