DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tin and HAT3

DIOPT Version :9

Sequence 1:NP_524433.1 Gene:tin / 42536 FlyBaseID:FBgn0004110 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_191598.1 Gene:HAT3 / 825210 AraportID:AT3G60390 Length:315 Species:Arabidopsis thaliana


Alignment Length:320 Identity:80/320 - (25%)
Similarity:118/320 - (36%) Gaps:88/320 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 DDGATTSSSL---------SPLLPPPPHQLYGGYQDYGMPAHMFQHHHGHPHQSFQHS------A 154
            |||...|.||         |..|.|.|   ...|.......||.|.::.|| |..|::      :
plant     5 DDGLGLSLSLSLGFNQKDPSSRLNPMP---LASYASSSHMQHMQQSNYNHP-QKIQNTWINMFQS 65

  Fly   155 SAYNMSASQFYAGASATAYQTPATYNYNYAGSGEVYGGATPSAV--GIKSEYIPTPYVTPSPTLD 217
            |..|.....|..|.......:....:....|:|.....:|.|:|  |.|||              
plant    66 SERNSDMRSFLRGIDVNRAPSTVVVDVEDEGAGVSSPNSTVSSVMSGKKSE-------------- 116

  Fly   218 LNSSAEVDSLQAPTQKLCVNPLSQRLMETASNSSSLRSIYGSDEGAKKKDNSQVTSSRSELRKNS 282
                                   :.||..|          |:..|.:.:||      ..|....|
plant   117 -----------------------RELMAAA----------GAVGGGRVEDN------EIERASCS 142

  Fly   283 ISGNSNPGSNSGSTKPRMKRKPRVLFSQAQVLELECRFRLKKYLTGAEREIIAQKLNLSATQVKI 347
            :.|.|:....||:.....::|.|:  |:.|.|.||..|:....|...::..:|::|||...||::
plant   143 LGGGSDDEDGSGNGDDSSRKKLRL--SKEQALVLEETFKEHSTLNPKQKMALAKQLNLRTRQVEV 205

  Fly   348 WFQNR--RYKSKRGDIDCEGI---AKHLKLKSEPLDSPTS------LPPPIPNHVMWPPT 396
            |||||  |.|.|:.::|||.:   .::|..::..|....|      |.|.:..| |.|||
plant   206 WFQNRRARTKLKQTEVDCEYLKRCCENLTDENRRLQKEVSELRALKLSPHLYMH-MKPPT 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tinNP_524433.1 HOX 301..357 CDD:197696 22/57 (39%)
HAT3NP_191598.1 HD-ZIP_N 19..118 CDD:398351 25/139 (18%)
Homeobox 165..215 CDD:395001 20/51 (39%)
HALZ 217..260 CDD:128634 10/43 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.