DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tin and HB4

DIOPT Version :9

Sequence 1:NP_524433.1 Gene:tin / 42536 FlyBaseID:FBgn0004110 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_182018.1 Gene:HB4 / 819100 AraportID:AT2G44910 Length:318 Species:Arabidopsis thaliana


Alignment Length:327 Identity:84/327 - (25%)
Similarity:126/327 - (38%) Gaps:97/327 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 QQSELPIPQQQLHHQHLDDGATTSSSLSPLLPPPPHQLYGGYQDYGMPAHMFQHHHGHPHQSFQH 152
            ||.|   |..:|:...|    |||||.|                      .|||.|...:.|  |
plant    18 QQKE---PSLRLNLMPL----TTSSSSS----------------------SFQHMHNQNNNS--H 51

  Fly   153 SASAYNMSASQFYAGASATAYQTPATYNYNYAGSGEVYGG----ATPSAVGIKSEYIPTPYVTPS 213
            ....:|:|.:..:  .|:...:|.|..|   :.:|....|    ...|:|.:             
plant    52 PQKIHNISWTHLF--QSSGIKRTTAERN---SDAGSFLRGFNVNRAQSSVAV------------- 98

  Fly   214 PTLDLNSSAEVDSLQAPTQKLCVNPLSQRLMETASNSSSLRSIYGSDEGAKKKDNSQVTSSRSEL 278
              :||...|.|  :.:|..  .|:.||       .|...|....|.||.         .:.|:..
plant    99 --VDLEEEAAV--VSSPNS--AVSSLS-------GNKRDLAVARGGDEN---------EAERASC 141

  Fly   279 RKNSISGNSNP---GSNSGSTKPRMKRKPRVLFSQAQVLELECRFRLKKYLTGAEREIIAQKLNL 340
            .:...||.|:.   |:..||.|       ::..|:.|.|.||..|:....|...::..:|::|||
plant   142 SRGGGSGGSDDEDGGNGDGSRK-------KLRLSKDQALVLEETFKEHSTLNPKQKLALAKQLNL 199

  Fly   341 SATQVKIWFQNR--RYKSKRGDIDCEGIAK---HLKLKSEPLDSPTS------LPPPIPNHVMWP 394
            .|.||::|||||  |.|.|:.::|||.:.:   :|..::..|....|      |.|.:..| |.|
plant   200 RARQVEVWFQNRRARTKLKQTEVDCEYLKRCCDNLTEENRRLQKEVSELRALKLSPHLYMH-MTP 263

  Fly   395 PT 396
            ||
plant   264 PT 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tinNP_524433.1 HOX 301..357 CDD:197696 21/57 (37%)
HB4NP_182018.1 HD-ZIP_N 8..124 CDD:398351 37/167 (22%)
Homeobox 166..216 CDD:395001 20/49 (41%)
HALZ 218..261 CDD:128634 10/43 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.