DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tin and HAT9

DIOPT Version :9

Sequence 1:NP_524433.1 Gene:tin / 42536 FlyBaseID:FBgn0004110 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_179865.1 Gene:HAT9 / 816811 AraportID:AT2G22800 Length:274 Species:Arabidopsis thaliana


Alignment Length:222 Identity:56/222 - (25%)
Similarity:96/222 - (43%) Gaps:43/222 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 TPSAVGIKSEYIPTPY-----------VTPSPTLDLNSSAEVDSLQAPTQKLCVNPLSQRLMETA 247
            |...:|:....||..|           :.||.||.|:....|..:....| ||        .:|:
plant     9 TGLVLGLGPSPIPNNYNSTIRQSSVYKLEPSLTLCLSGDPSVTVVTGADQ-LC--------RQTS 64

  Fly   248 SNSSSLRSIYGSDEGAKK-KDNSQVTSSRSELRKNSISG-NSNPGSNSGSTKPRMKRKPRVLFSQ 310
            |:|..  |.:.|....|: :|..:.:....|:.:..||. :.:....|...|.|:.::...|   
plant    65 SHSGV--SSFSSGRVVKRERDGGEESPEEEEMTERVISDYHEDEEGISARKKLRLTKQQSAL--- 124

  Fly   311 AQVLELECRFRLKKYLTGAEREIIAQKLNLSATQVKIWFQNR--RYKSKRGDIDCEGIAK----- 368
                 ||..|:....|...:::::|::|||...||::|||||  |.|.|:.::|||.:.|     
plant   125 -----LEESFKDHSTLNPKQKQVLARQLNLRPRQVEVWFQNRRARTKLKQTEVDCEFLKKCCETL 184

  Fly   369 ---HLKLKSEPLDSPT-SLPPPIPNHV 391
               :::|:.|..:..| .|..|...|:
plant   185 ADENIRLQKEIQELKTLKLTQPFYMHM 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tinNP_524433.1 HOX 301..357 CDD:197696 18/57 (32%)
HAT9NP_179865.1 HOX 112..166 CDD:197696 19/61 (31%)
HALZ 168..211 CDD:128634 10/42 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.