DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tin and NKX2-4

DIOPT Version :9

Sequence 1:NP_524433.1 Gene:tin / 42536 FlyBaseID:FBgn0004110 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_149416.1 Gene:NKX2-4 / 644524 HGNCID:7837 Length:354 Species:Homo sapiens


Alignment Length:382 Identity:108/382 - (28%)
Similarity:154/382 - (40%) Gaps:111/382 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 NTTPFSVKDILNMVNQTEAYEGSYGHIDGA--ATASALFAAGEYQNPHQYLNHQQHQQSELPIPQ 96
            :||||||.|||:.:.:|  |:...|.:|||  ...:.|.||..|:.|.             |.|.
Human     7 HTTPFSVSDILSPIEET--YKKFSGAMDGAPPGLGAPLGAAAAYRAPP-------------PGPS 56

  Fly    97 QQLHHQHLDDGATTSSSLSPLLPPPPHQLYGGYQDYGMPAHMFQHHHGHPHQSFQHSASAYNMSA 161
            .|         |.|.:.:.     |.|.:.|                        |:|:| ..:|
Human    57 SQ---------AATVAGMQ-----PSHAMAG------------------------HNAAA-AAAA 82

  Fly   162 SQFYAGASATAYQTPATYNYNYAGSGEVYGGATPSAVGIKSEYIPTPYVTPSPTLDLNSSAEVDS 226
            :...|.|:||.:..|....:.:...|....|    .:|...| :|               |..|.
Human    83 AAAAAAAAATYHMPPGVSQFPHGAMGSYCNG----GLGNMGE-LP---------------AYTDG 127

  Fly   227 LQ--APTQKLCVNP------LSQRLMETAS-NSSSLRSIYGSDEGAKKKDNSQVTSSRSELRKNS 282
            ::  |.|.....||      :|:.:..:|. |.:.:.|:.|..:.||         |...|.   
Human   128 MRGGAATGWYGANPDPRYSSISRFMGPSAGVNVAGMGSLTGIADAAK---------SLGPLH--- 180

  Fly   283 ISGNSNPGSNSGSTKPRMKRKPRVLFSQAQVLELECRFRLKKYLTGAEREIIAQKLNLSATQVKI 347
                    :.:.:..||.||  |||||||||.|||.||:.:|||:..|||.:|..::|:.|||||
Human   181 --------AAAAAAAPRRKR--RVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKI 235

  Fly   348 WFQNRRYKSKRGDIDCEGIAKHLKLKSEPLDSPTSLPPPIPNHVMWPPTMQQSQQQQ 404
            ||||.|||.||...|    ....:|:.|....|...|||.|..|..|..::..:..|
Human   236 WFQNHRYKMKRQAKD----KAAQQLQQEGGLGPPPPPPPSPRRVAVPVLVKDGKPCQ 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tinNP_524433.1 HOX 301..357 CDD:197696 36/55 (65%)
NKX2-4NP_149416.1 Homeobox 192..245 CDD:278475 35/54 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 246..329 12/47 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.