DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tin and hoxc13a

DIOPT Version :9

Sequence 1:NP_524433.1 Gene:tin / 42536 FlyBaseID:FBgn0004110 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_571618.1 Gene:hoxc13a / 58059 ZFINID:ZDB-GENE-000822-4 Length:306 Species:Danio rerio


Alignment Length:294 Identity:69/294 - (23%)
Similarity:108/294 - (36%) Gaps:88/294 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 HPHQS------FQHSASAYNMSASQFYAGASATAYQTPATYNY---------NYAGS-----GEV 189
            ||..:      ::.|.:..|.:.||...|.|...   |||:..         .::|:     |.|
Zfish     8 HPRWADTLMYVYEKSPNENNQNKSQIMEGLSGNC---PATHCRELISHPALGRHSGTIATHQGSV 69

  Fly   190 YGGATPSAVGIKSEYIPTPYVTPSPTLD-------------LNSSAEVDSLQAP----------- 230
            |...:....|   ...|.|..:.|.:|.             |:.|..|:..|.|           
Zfish    70 YSDISSPETG---RQCPAPQTSSSASLSYGYPFGNPYYGCRLSHSHNVNLQQKPCSYHPAEKYAE 131

  Fly   231 -TQKLCVNPLSQRLMETA---SNSSSLRSIYG----------SDEGAKKKD-------------- 267
             :..|....||.|..|.|   |.:||.:::.|          |.....:.|              
Zfish   132 TSSALPTEELSSRAKEFAFYPSLASSYQAVPGYLDMSVVPSISVHPEPRHDALIPMEGYQHWALS 196

  Fly   268 ---NSQVTSSRSELRKNSISGNSNPGSNSGSTKP-----RMKRKPRVLFSQAQVLELECRFRLKK 324
               :.||..|:.:.:.:.:.  .:|..:....:|     |..||.||.:::.|:.|||..:...|
Zfish   197 NGWDGQVYCSKEQTQSSHLW--KSPFPDVVPLQPEVSSYRRGRKKRVPYTKIQLKELEKEYAASK 259

  Fly   325 YLTGAEREIIAQKLNLSATQVKIWFQNRRYKSKR 358
            ::|..:|..|:...|||..||.|||||||.|.|:
Zfish   260 FITKDKRRRISATTNLSERQVTIWFQNRRVKEKK 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tinNP_524433.1 HOX 301..357 CDD:197696 25/55 (45%)
hoxc13aNP_571618.1 HoxA13_N 31..142 CDD:289085 22/116 (19%)
Homeobox 239..292 CDD:278475 23/52 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.