DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tin and NKX3-2

DIOPT Version :9

Sequence 1:NP_524433.1 Gene:tin / 42536 FlyBaseID:FBgn0004110 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001180.1 Gene:NKX3-2 / 579 HGNCID:951 Length:333 Species:Homo sapiens


Alignment Length:286 Identity:82/286 - (28%)
Similarity:117/286 - (40%) Gaps:74/286 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 GASATAYQTPATYNYNYAGSGE--VYGGA----------TPSAVGIKSEYIPTPYVTPSPTLDLN 219
            |.:|:....||...:...|..:  ..|||          |.:|.|..:| .|..:.:.|...:.|
Human    38 GTAASVAAAPAVCCWRLFGERDAGALGGAEDSLLASPAGTRTAAGRTAE-SPEGWDSDSALSEEN 101

  Fly   220 SSAEVDSLQAPTQKLCVNPLSQRLMETASNSSSLRSIYGSD--EGAKKKDNSQVTSSRSELRKN- 281
            .|          ::.|.:.........|..|.||    |..  |.|..||..:..:.||:...: 
Human   102 ES----------RRRCADARGASGAGLAGGSLSL----GQPVCELAASKDLEEEAAGRSDSEMSA 152

  Fly   282 SISGNSNP-----------------------GSNSG------------STKPRMKRKPRVLFSQA 311
            |:||:.:|                       |..||            :.|||.||. |..||.|
Human   153 SVSGDRSPRTEDDGVGPRGAHVSALCSGAGGGGGSGPAGVAEEEEEPAAPKPRKKRS-RAAFSHA 216

  Fly   312 QVLELECRFRLKKYLTGAEREIIAQKLNLSATQVKIWFQNRRYKSKRGDIDCEGI-----AKHLK 371
            ||.|||.||..::||:|.||..:|..|.|:.|||||||||||||:||..:..:.:     ||.:.
Human   217 QVFELERRFNHQRYLSGPERADLAASLKLTETQVKIWFQNRRYKTKRRQMAADLLASAPAAKKVA 281

  Fly   372 LKSEPLDSPTSLPPPIPNHVMWPPTM 397
            :|....|.....   :|..|:.||::
Human   282 VKVLVRDDQRQY---LPGEVLRPPSL 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tinNP_524433.1 HOX 301..357 CDD:197696 34/55 (62%)
NKX3-2NP_001180.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 65..113 11/58 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 138..212 15/74 (20%)
Homeobox 209..262 CDD:278475 32/53 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.