DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tin and hoxb13a

DIOPT Version :9

Sequence 1:NP_524433.1 Gene:tin / 42536 FlyBaseID:FBgn0004110 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001038377.1 Gene:hoxb13a / 559921 ZFINID:ZDB-GENE-050812-1 Length:303 Species:Danio rerio


Alignment Length:251 Identity:69/251 - (27%)
Similarity:103/251 - (41%) Gaps:47/251 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 GHPHQSFQHSASAYNM---SASQFYAGASATAYQT--------PATYNY---NY----AGSGEVY 190
            ||| .|..|.:|...:   ::|...:|...|...|        |..|.|   :|    .|.|.:.
Zfish    54 GHP-SSLVHGSSYPTVDVSTSSSAESGKQCTPCPTVPQASSTGPIPYGYFGNSYYPCRMGRGSLK 117

  Fly   191 GGATPSAVGIKSE-YIPTP-----YVT-----------PSPTLDLNSSAEVDSLQAPTQKLCVNP 238
            ....|||:...:| |:.||     |.|           |||...:.|..:|..:|.....   .|
Zfish   118 SCTQPSALSYTAEKYMDTPVTSEEYPTRAKEFAFYHSYPSPYQSMASYLDVSVVQTLGTG---EP 179

  Fly   239 LSQRLMETASNSS-SLRSIYGSDEGAKKKDNSQVTSSRSELRKNSISGNSNPGSNSGSTKPRMKR 302
            ....|:...|... :|.:.:||.... .||..|.    ..|.|::::.......:.||.  |..|
Zfish   180 RHDSLLPMDSYQPWALANGWGSQMYC-SKDQGQA----GHLWKSALADVVAHQHDGGSF--RRGR 237

  Fly   303 KPRVLFSQAQVLELECRFRLKKYLTGAEREIIAQKLNLSATQVKIWFQNRRYKSKR 358
            |.|:.:::.|:.|||..:...|::|..:|..|:...|||..|:.|||||||.|.|:
Zfish   238 KKRIPYTKVQLKELEKEYAANKFITKDKRRKISAVTNLSERQITIWFQNRRVKEKK 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tinNP_524433.1 HOX 301..357 CDD:197696 23/55 (42%)
hoxb13aNP_001038377.1 HoxA13_N 27..143 CDD:289085 23/89 (26%)
homeodomain 237..293 CDD:238039 23/55 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.