DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tin and nkx3-1

DIOPT Version :9

Sequence 1:NP_524433.1 Gene:tin / 42536 FlyBaseID:FBgn0004110 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001373254.1 Gene:nkx3-1 / 555375 ZFINID:ZDB-GENE-081104-238 Length:185 Species:Danio rerio


Alignment Length:131 Identity:45/131 - (34%)
Similarity:67/131 - (51%) Gaps:13/131 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 ASNSSSLRSIYGSD-----EGAKKKDNSQVTSSRSELRKNSISG----NSNPGSNSGSTKPR--- 299
            |:::..|.|.:..|     |..|.:|:....|.|.:........    .::.|....||:..   
Zfish     2 ATSNKQLTSFFIEDILSLKEDKKDEDSCNAESDRDDSTDRQTDSADTCRTSEGKTVSSTEMTGGG 66

  Fly   300 -MKRKPRVLFSQAQVLELECRFRLKKYLTGAEREIIAQKLNLSATQVKIWFQNRRYKSKRGDIDC 363
             .|::.|..|:..||||||.:|..::||:..||..:|..|:|:.|||||||||||||:||..:..
Zfish    67 GKKKRSRAAFTHLQVLELEKKFSRQRYLSAPERTHLASALHLTETQVKIWFQNRRYKTKRRQLTT 131

  Fly   364 E 364
            |
Zfish   132 E 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tinNP_524433.1 HOX 301..357 CDD:197696 30/55 (55%)
nkx3-1NP_001373254.1 COG5576 15..>136 CDD:227863 42/118 (36%)
Homeobox 72..126 CDD:395001 29/53 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.