DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tin and nkx2.2b

DIOPT Version :9

Sequence 1:NP_524433.1 Gene:tin / 42536 FlyBaseID:FBgn0004110 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001007783.2 Gene:nkx2.2b / 493627 ZFINID:ZDB-GENE-050217-3 Length:237 Species:Danio rerio


Alignment Length:195 Identity:62/195 - (31%)
Similarity:87/195 - (44%) Gaps:46/195 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 DEGAKKKDNSQVTSSRSELRKNSISGNS-----------NPGSNSGSTKPR-------MKRKPRV 306
            |||.......|..|||..|...|..|:.           ||..::..:..|       .|||.|:
Zfish    36 DEGLNANQKKQHDSSRDALWLGSSCGHKYPVPSASPEELNPELSADESVDRESSEDSGKKRKRRI 100

  Fly   307 LFSQAQVLELECRFRLKKYLTGAEREIIAQKLNLSATQVKIWFQNRRYKSKRGDIDCEGIAKHLK 371
            |||:.|..|||.|||.::||:..|||.:|:.|:|:.|||||||||.|||.||...: :|:..:|.
Zfish   101 LFSKTQTFELERRFRQQRYLSAPEREHLAKLLHLTPTQVKIWFQNHRYKVKRARAE-KGLDPYLL 164

  Fly   372 LKSEPLDSPTSLPPPI------PNHVMWPPTMQQS--------------QQQQQHHAQQQQMQHM 416
                   ||..:..|:      |.|::.|..:..|              ...|.||:....:.|:
Zfish   165 -------SPRRVSIPVLVRDGRPCHLLGPQDITASIPPATAPFTAFNMKPFPQIHHSHNNIVTHL 222

  Fly   417  416
            Zfish   223  222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tinNP_524433.1 HOX 301..357 CDD:197696 34/55 (62%)
nkx2.2bNP_001007783.2 Homeobox 98..151 CDD:278475 31/52 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.