DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tin and NKX3-1

DIOPT Version :9

Sequence 1:NP_524433.1 Gene:tin / 42536 FlyBaseID:FBgn0004110 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_006158.2 Gene:NKX3-1 / 4824 HGNCID:7838 Length:234 Species:Homo sapiens


Alignment Length:194 Identity:61/194 - (31%)
Similarity:86/194 - (44%) Gaps:36/194 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 PSPTLDLNSSAEVDSLQAPTQKLCVNPLSQRLMETASNSSSLRSIYGSDEGAKKK---DNSQV-T 272
            |:|:..|.|....|.|:...|:......|||..:.......      ..||.:.:   .|.|: |
Human    20 PTPSKPLTSFLIQDILRDGAQRQGGRTSSQRQRDPEPEPEP------EPEGGRSRAGAQNDQLST 78

  Fly   273 SSRSELRKNSISGNSNP----GS------NSGSTKPRMKRKP-------RVLFSQAQVLELECRF 320
            ..|:...:......:.|    ||      |:....||:.:.|       |..||..||:|||.:|
Human    79 GPRAAPEEAETLAETEPERHLGSYLLDSENTSGALPRLPQTPKQPQKRSRAAFSHTQVIELERKF 143

  Fly   321 RLKKYLTGAEREIIAQKLNLSATQVKIWFQNRRYKSKRGDIDCEGIAKHLKLKSEPLDSPTSLP 384
            ..:|||:..||..:|:.|.|:.|||||||||||||:||         |.|..:...|:..:|||
Human   144 SHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTKR---------KQLSSELGDLEKHSSLP 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tinNP_524433.1 HOX 301..357 CDD:197696 31/62 (50%)
NKX3-1NP_006158.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..131 24/116 (21%)
Homeobox 127..180 CDD:278475 30/52 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.