DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tin and NKX2-2

DIOPT Version :9

Sequence 1:NP_524433.1 Gene:tin / 42536 FlyBaseID:FBgn0004110 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_002500.1 Gene:NKX2-2 / 4821 HGNCID:7835 Length:273 Species:Homo sapiens


Alignment Length:230 Identity:76/230 - (33%)
Similarity:106/230 - (46%) Gaps:44/230 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 PTPYVTPSPTLDLNSSAEVDSLQA-----PTQKLCVNPLSQRLMETASNSSSLRSIYGSDEGAKK 265
            |.|.....|   |...| :|::|:     |......||.::.|   ||......|::|...||..
Human    39 PEPAKRAGP---LGQGA-LDAVQSLPLKNPFYDSSDNPYTRWL---ASTEGLQYSLHGLAAGAPP 96

  Fly   266 KDNSQVTSSRSELRKNSISGNSNPGSNSGSTKPRMKRKPRVLFSQAQVLELECRFRLKKYLTGAE 330
            :|:|. .|......::..:....||....:.|   |||.|||||:||..|||.|||.::||:..|
Human    97 QDSSS-KSPEPSADESPDNDKETPGGGGDAGK---KRKRRVLFSKAQTYELERRFRQQRYLSAPE 157

  Fly   331 REIIAQKLNLSATQVKIWFQNRRYKSKRGDIDCEGIAKHLKLKSEPLDSPTSLPPPI------PN 389
            ||.:|..:.|:.|||||||||.|||.||...: :|      ::..||.||..:..|:      |.
Human   158 REHLASLIRLTPTQVKIWFQNHRYKMKRARAE-KG------MEVTPLPSPRRVAVPVLVRDGKPC 215

  Fly   390 HV-----MWPPTMQ----------QSQQQQQHHAQ 409
            |.     :...|.|          ||.|..|::||
Human   216 HALKAQDLAAATFQAGIPFSAYSAQSLQHMQYNAQ 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tinNP_524433.1 HOX 301..357 CDD:197696 35/55 (64%)
NKX2-2NP_002500.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..56 6/20 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..131 10/44 (23%)
Homeobox 131..185 CDD:395001 32/53 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.