DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tin and zen

DIOPT Version :9

Sequence 1:NP_524433.1 Gene:tin / 42536 FlyBaseID:FBgn0004110 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_476793.1 Gene:zen / 40828 FlyBaseID:FBgn0004053 Length:353 Species:Drosophila melanogaster


Alignment Length:168 Identity:52/168 - (30%)
Similarity:72/168 - (42%) Gaps:33/168 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 NSQVTS-----SRSELRKNSISGNSNPGS--NSGSTKPRMKRKPRVLFSQAQVLELECRFRLKKY 325
            ||..|:     |...:.:..:|.:.|..|  |..|.:.::||. |..|:..|::|||..|:...|
  Fly    51 NSNPTTLNDHCSPQHVHQQHVSSDENLPSQPNHDSQRVKLKRS-RTAFTSVQLVELENEFKSNMY 114

  Fly   326 LTGAEREIIAQKLNLSATQVKIWFQNRRYKSKRGDID--------------------CEGIAKHL 370
            |....|..|||:|:|...||||||||||.|.|: ||.                    ..||.|.|
  Fly   115 LYRTRRIEIAQRLSLCERQVKIWFQNRRMKFKK-DIQGHREPKSNAKLAQPQAEQSAHRGIVKRL 178

  Fly   371 KLKSEPLDSPTSLPPPIPNHVMWP----PTMQQSQQQQ 404
            ...|:.....|:.....|...:.|    |..|.||:.:
  Fly   179 MSYSQDPREGTAAAEKRPMMAVAPVNPKPDYQASQKMK 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tinNP_524433.1 HOX 301..357 CDD:197696 28/55 (51%)
zenNP_476793.1 Homeobox 93..146 CDD:278475 26/53 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 73 1.000 Inparanoid score I2435
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.